Gene Gene information from NCBI Gene database.
Entrez ID 9557
Gene name Chromodomain helicase DNA binding protein 1 like
Gene symbol CHD1L
Synonyms (NCBI Gene)
ALC1CHDL
Chromosome 1
Chromosome location 1q21.1
Summary This gene encodes a DNA helicase protein involved in DNA repair. The protein converts ATP to add poly(ADP-ribose) as it regulates chromatin relaxation following DNA damage. Overexpression of this gene has been linked to several types of cancers. [provided
SNPs SNP information provided by dbSNP.
1
SNP ID Visualize variation Clinical significance Consequence
rs782144677 A>- Pathogenic Coding sequence variant, frameshift variant, non coding transcript variant
miRNA miRNA information provided by mirtarbase database.
24
miRTarBase ID miRNA Experiments Reference
MIRT044802 hsa-miR-320a CLASH 23622248
MIRT1963410 hsa-miR-326 CLIP-seq
MIRT1963411 hsa-miR-330-5p CLIP-seq
MIRT1963412 hsa-miR-555 CLIP-seq
MIRT2199871 hsa-miR-5095 CLIP-seq
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
32
GO ID Ontology Definition Evidence Reference
GO:0000166 Function Nucleotide binding IBA
GO:0000166 Function Nucleotide binding IDA 19661379
GO:0000166 Function Nucleotide binding IEA
GO:0003678 Function DNA helicase activity IEA
GO:0003678 Function DNA helicase activity TAS 19661379
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
MIM HGNC e!Ensembl
613039 1916 ENSG00000131778
Protein Protein information from UniProt database.
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q86WJ1
Protein name Chromodomain-helicase-DNA-binding protein 1-like (EC 3.6.4.-) (Amplified in liver cancer protein 1)
Protein function ATP-dependent chromatin remodeler that mediates chromatin-remodeling following DNA damage (PubMed:19661379, PubMed:29220652, PubMed:29220653, PubMed:33357431, PubMed:34210977, PubMed:34486521, PubMed:34874266). Recruited to DNA damage sites thro
PDB 6ZHX , 6ZHY , 7ENN , 7EPU , 7OTQ , 8B0A
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00176 SNF2_N 57 328 SNF2 family N-terminal domain Family
PF00271 Helicase_C 347 459 Helicase conserved C-terminal domain Family
Tissue specificity TISSUE SPECIFICITY: Frequently overexpressed in hepatomacellular carcinomas. {ECO:0000269|PubMed:18023026}.
Sequence
MERAGATSRGGQAPGFLLRLHTEGRAEAARVQEQDLRQWGLTGIHLRSYQLEGVNWLAQR
FHCQNGCILGDEMGLGKTCQTIALFIYLAGRLNDEGPFLILCPLSVLSNWKEEMQRFAPG
LSCVTYAGDKEERACLQQDLKQESRFHVLLTTYEICLKDASFLKSFPWSVLVVDEAHRLK
NQSSLLHKTLSEFSVVFSLLLTGTPIQNSLQELYSLLSFVEPDLFSKEEVGDFIQRYQDI
EKESESASELHKLLQPFLLRRVKAEVATELPKKTEVVIYHGMSALQKKYYKAILMKDLDA
FENETAKKVKLQNILSQLRKCVDHPYLF
DGVEPEPFEVGDHLTEASGKLHLLDKLLAFLY
SGGHRVLLFSQMTQMLDILQDYMDYRGYSYERVDGSVRGEERHLAIKNFGQQPIFVFLLS
TRAGGVGMNLTAADTVIFVDSDFNPQNDLQAAARAHRIG
QNKSVKVIRLIGRDTVEEIVY
RKAASKLQLTNMIIEGGHFTLGAQKPAADADLQLSEILKFGLDKLLASEGSTMDEIDLES
ILGETKDGQWVSDALPAAEGGSRDQEEGKNHMYLFEGKDYSKEPSKEDRKSFEQLVNLQK
TLLEKASQEGRSLRNKGSVLIPGLVEGSTKRKRVLSPEELEDRQKKRQEAAAKRRRLIEE
KKRQKEEAEHKKKMAWWESNNYQSFCLPSEESEPEDLENGEESSAELDYQDPDATSLKYV
SGDVTHPQAGAEDALIVHCVDDSGHWGRGGLFTALEKRSAEPRKIYELAGKMKDLSLGGV
LLFPVDDKESRNKGQDLLALIVAQHRDRSNVLSGIKMAALEEGLKKIFLAAKKKKASVHL
PRIGHATKGFNWYGTERLIRKHLAARGIPTYIYYFPRSKSAVLHSQSSSSSSRQLVP
Sequence length 897
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  Reactome
    Formation of Incision Complex in GG-NER
Dual Incision in GG-NER
Associated diseases Disease associations from ClinVar (causal & non-causal) and other databases (OMIM, Orphanet, GWAS, etc.).
28
Evidence Score: ★☆☆☆☆  Gene-disease association found in Text Mining only ★★☆☆☆  Found in Text Mining and Unknown/Other Associations ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
Phenotype Name Clinical Significance Source Evidence Score
Abnormality of the urinary system Uncertain significance ClinVar
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
CAKUT Disgenet
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
Cervical cancer Likely benign ClinVar
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
CHD1L-related disorder Benign; Likely benign; Uncertain significance ClinVar
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
Associations from Text Mining Disease associations identified through text mining
Disease Name Disease (Merged) Source PMID Relationship Type Evidence Score
Adenocarcinoma Adenocarcinoma BEFREE 26360781
★☆☆☆☆
Found in Text Mining only
Adenocarcinoma of lung (disorder) Lung adenocarcinoma BEFREE 26360781
★☆☆☆☆
Found in Text Mining only
Attention Deficit Disorder with Hyperactivity Attention deficit hyperactivity disorder Pubtator 28332277 Associate
★☆☆☆☆
Found in Text Mining only
Bilateral renal dysplasia Bilateral renal dysplasia BEFREE 31759543
★☆☆☆☆
Found in Text Mining only
Breast Carcinoma Breast Carcinoma BEFREE 25153161, 26599012, 30972184, 31322269
★☆☆☆☆
Found in Text Mining only
Breast Diseases Breast disease Pubtator 33275888 Associate
★☆☆☆☆
Found in Text Mining only
Breast Neoplasms Breast neoplasm Pubtator 25153161, 33462394, 39201277 Associate
★☆☆☆☆
Found in Text Mining only
Cakut Congenital anomalies of kidney and urinary tract BEFREE 22146311
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
Cakut Congenital anomalies of kidney and urinary tract CLINGEN_DG 22146311, 24429398
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
Cakut Congenital anomalies of kidney and urinary tract GENOMICS_ENGLAND_DG 22146311, 24429398
★★☆☆☆
Found in Text Mining + Unknown/Other Associations