Gene Gene information from NCBI Gene database.
Entrez ID 9547
Gene name C-X-C motif chemokine ligand 14
Gene symbol CXCL14
Synonyms (NCBI Gene)
BMACBRAKKECKS1MIP-2gMIP2GNJACSCYB14
Chromosome 5
Chromosome location 5q31.1
Summary This antimicrobial gene belongs to the cytokine gene family which encode secreted proteins involved in immunoregulatory and inflammatory processes. The protein encoded by this gene is structurally related to the CXC (Cys-X-Cys) subfamily of cytokines. Mem
miRNA miRNA information provided by mirtarbase database.
36
miRTarBase ID miRNA Experiments Reference
MIRT739459 hsa-miR-3119 PAR-CLIP 27292025
MIRT739459 hsa-miR-3119 HITS-CLIP 27418678
MIRT739459 hsa-miR-3119 HITS-CLIP 28735896
MIRT736790 hsa-miR-582-3p Luciferase reporter assayWestern blottingRNA-seq 33312754
MIRT917944 hsa-miR-1289 CLIP-seq
Transcription factors Transcription factors information provided by TRRUST V2 database.
1
Transcription factor Regulation Reference
SP1 Activation 22382027
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
16
GO ID Ontology Definition Evidence Reference
GO:0005125 Function Cytokine activity IEA
GO:0005515 Function Protein binding IPI 25416956, 28381538
GO:0005576 Component Extracellular region IEA
GO:0005615 Component Extracellular space IEA
GO:0005794 Component Golgi apparatus IDA
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
MIM HGNC e!Ensembl
604186 10640 ENSG00000145824
Protein Protein information from UniProt database.
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
O95715
Protein name C-X-C motif chemokine 14 (Chemokine BRAK) (MIP-2G) (Small-inducible cytokine B14)
Protein function Potent chemoattractant for neutrophils, and weaker for dendritic cells. Not chemotactic for T-cells, B-cells, monocytes, natural killer cells or granulocytes. Does not inhibit proliferation of myeloid progenitors in colony formation assays. {ECO
PDB 2HDL
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00048 IL8 35 99 Small cytokines (intecrine/chemokine), interleukin-8 like Domain
Tissue specificity TISSUE SPECIFICITY: Expressed in heart, brain, placenta, lung, liver, skeletal muscle, kidney and pancreas. Highly expressed in normal tissue without inflammatory stimuli and infrequently expressed in cancer cell lines. Weakly expressed in monocyte-derive
Sequence
MSLLPRRAPPVSMRLLAAALLLLLLALYTARVDGSKCKCSRKGPKIRYSDVKKLEMKPKY
PHCEEKMVIITTKSVSRYRGQEHCLHPKLQSTKRFIKWY
NAWNEKRRVYEE
Sequence length 111
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  KEGG 
  Cytokine-cytokine receptor interaction
Viral protein interaction with cytokine and cytokine receptor
Chemokine signaling pathway
 
Associated diseases Disease associations from ClinVar (causal & non-causal) and other databases (OMIM, Orphanet, GWAS, etc.).
7
Evidence Score: ★☆☆☆☆  Gene-disease association found in Text Mining only ★★☆☆☆  Found in Text Mining and Unknown/Other Associations ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
Phenotype Name Clinical Significance Source Evidence Score
ASTHMA CTD, Disgenet
CTD, Disgenet
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
CARCINOMA, HEPATOCELLULAR CTD
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
CONTACT DERMATITIS Disgenet
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
DERMATITIS, CONTACT CTD
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
Associations from Text Mining Disease associations identified through text mining
Disease Name Disease (Merged) Source PMID Relationship Type Evidence Score
Adenocarcinoma Adenocarcinoma BEFREE 23597004
★☆☆☆☆
Found in Text Mining only
Adenocarcinoma of lung (disorder) Lung adenocarcinoma BEFREE 23597004
★☆☆☆☆
Found in Text Mining only
Arteriosclerosis Arteriosclerosis BEFREE 31728901
★☆☆☆☆
Found in Text Mining only
Asthma Asthma CTD_human_DG 21150878
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
Astrocytoma Astrocytoma Pubtator 26497896 Associate
★☆☆☆☆
Found in Text Mining only
Atherosclerosis Atherosclerosis BEFREE 31728901
★☆☆☆☆
Found in Text Mining only
Benign Prostatic Hyperplasia Benign Prostatic Hyperplasia BEFREE 27787597
★☆☆☆☆
Found in Text Mining only
Brain Neoplasms Brain neoplasms Pubtator 33878734 Inhibit
★☆☆☆☆
Found in Text Mining only
Breast Carcinoma Breast Carcinoma BEFREE 18678474, 22910931, 23294544, 24089458, 27115465, 30204129, 30850359
★☆☆☆☆
Found in Text Mining only
Breast Neoplasms Breast neoplasm Pubtator 18765527, 23294544, 27115465, 29495008, 31117166, 35725915, 37996875 Associate
★☆☆☆☆
Found in Text Mining only