Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	954
Gene name	Ectonucleoside triphosphate diphosphohydrolase 2
Gene symbol	ENTPD2
Synonyms (NCBI Gene)	CD39L1NTPDase-2
Chromosome	9
Chromosome location	9q34.3
Summary	The protein encoded by this gene is the type 2 enzyme of the ecto-nucleoside triphosphate diphosphohydrolase family (E-NTPDase). E-NTPDases are a family of ecto-nucleosidases that hydrolyze 5`-triphosphates. This ecto-ATPase is an integral membrane protei

Show/Hide all (70)

miRTarBase ID	miRNA	Experiments
MIRT964508	hsa-miR-1293	CLIP-seq
MIRT964509	hsa-miR-3148	CLIP-seq
MIRT964510	hsa-miR-4282	CLIP-seq
MIRT964511	hsa-miR-4450	CLIP-seq
MIRT964512	hsa-miR-4483	CLIP-seq
MIRT964513	hsa-miR-4651	CLIP-seq
MIRT964514	hsa-miR-491-5p	CLIP-seq
MIRT964515	hsa-miR-520d-5p	CLIP-seq
MIRT964516	hsa-miR-524-5p	CLIP-seq
MIRT964517	hsa-miR-548ae	CLIP-seq
MIRT964518	hsa-miR-548aj	CLIP-seq
MIRT964519	hsa-miR-548am	CLIP-seq
MIRT964520	hsa-miR-548x	CLIP-seq
MIRT964521	hsa-miR-556-3p	CLIP-seq
MIRT964522	hsa-miR-608	CLIP-seq
MIRT964523	hsa-miR-1275	CLIP-seq
MIRT964524	hsa-miR-342-5p	CLIP-seq
MIRT964525	hsa-miR-4447	CLIP-seq
MIRT964526	hsa-miR-4472	CLIP-seq
MIRT964527	hsa-miR-4525	CLIP-seq
MIRT964513	hsa-miR-4651	CLIP-seq
MIRT964528	hsa-miR-4664-5p	CLIP-seq
MIRT964529	hsa-miR-4665-5p	CLIP-seq
MIRT964530	hsa-miR-4723-5p	CLIP-seq
MIRT964522	hsa-miR-608	CLIP-seq
MIRT964531	hsa-miR-625	CLIP-seq
MIRT964523	hsa-miR-1275	CLIP-seq
MIRT964508	hsa-miR-1293	CLIP-seq
MIRT1985816	hsa-miR-3135b	CLIP-seq
MIRT964524	hsa-miR-342-5p	CLIP-seq
MIRT1985817	hsa-miR-3652	CLIP-seq
MIRT1985818	hsa-miR-3929	CLIP-seq
MIRT1985819	hsa-miR-4419b	CLIP-seq
MIRT1985820	hsa-miR-4430	CLIP-seq
MIRT964525	hsa-miR-4447	CLIP-seq
MIRT964526	hsa-miR-4472	CLIP-seq
MIRT1985821	hsa-miR-4478	CLIP-seq
MIRT964512	hsa-miR-4483	CLIP-seq
MIRT1985822	hsa-miR-4492	CLIP-seq
MIRT1985823	hsa-miR-4498	CLIP-seq
MIRT964527	hsa-miR-4525	CLIP-seq
MIRT964513	hsa-miR-4651	CLIP-seq
MIRT1985824	hsa-miR-4656	CLIP-seq
MIRT964528	hsa-miR-4664-5p	CLIP-seq
MIRT964529	hsa-miR-4665-5p	CLIP-seq
MIRT964530	hsa-miR-4723-5p	CLIP-seq
MIRT1985825	hsa-miR-486-3p	CLIP-seq
MIRT964522	hsa-miR-608	CLIP-seq
MIRT964531	hsa-miR-625	CLIP-seq
MIRT1985826	hsa-miR-762	CLIP-seq
MIRT2448876	hsa-miR-125a-5p	CLIP-seq
MIRT2448877	hsa-miR-125b	CLIP-seq
MIRT2448878	hsa-miR-3150b-3p	CLIP-seq
MIRT2448879	hsa-miR-326	CLIP-seq
MIRT2448880	hsa-miR-330-5p	CLIP-seq
MIRT2448881	hsa-miR-4319	CLIP-seq
MIRT2448882	hsa-miR-4639-3p	CLIP-seq
MIRT2448883	hsa-miR-4689	CLIP-seq
MIRT2448884	hsa-miR-4784	CLIP-seq
MIRT2448885	hsa-miR-516b	CLIP-seq
MIRT2448886	hsa-miR-544b	CLIP-seq
MIRT2448887	hsa-miR-765	CLIP-seq
MIRT2448876	hsa-miR-125a-5p	CLIP-seq
MIRT2448877	hsa-miR-125b	CLIP-seq
MIRT2448878	hsa-miR-3150b-3p	CLIP-seq
MIRT2448881	hsa-miR-4319	CLIP-seq
MIRT2448883	hsa-miR-4689	CLIP-seq
MIRT2448884	hsa-miR-4784	CLIP-seq
MIRT2448886	hsa-miR-544b	CLIP-seq
MIRT2448887	hsa-miR-765	CLIP-seq

Show/Hide all (21)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000166	Function	Nucleotide binding	IEA
GO:0004382	Function	GDP phosphatase activity	IBA
GO:0005515	Function	Protein binding	IPI	32814053
GO:0005524	Function	ATP binding	IEA
GO:0005604	Component	Basement membrane	IEA
GO:0005783	Component	Endoplasmic reticulum	IEA
GO:0005789	Component	Endoplasmic reticulum membrane	IEA
GO:0005886	Component	Plasma membrane	IBA
GO:0005886	Component	Plasma membrane	IEA
GO:0005886	Component	Plasma membrane	TAS
GO:0007186	Process	G protein-coupled receptor signaling pathway	IEA
GO:0009134	Process	Nucleoside diphosphate catabolic process	IBA
GO:0009181	Process	Purine ribonucleoside diphosphate catabolic process	IEA
GO:0016020	Component	Membrane	IEA
GO:0016787	Function	Hydrolase activity	IEA
GO:0017110	Function	Nucleoside diphosphate phosphatase activity	IEA
GO:0017111	Function	Ribonucleoside triphosphate phosphatase activity	IBA
GO:0017111	Function	Ribonucleoside triphosphate phosphatase activity	IEA
GO:0030168	Process	Platelet activation	IEA
GO:0045134	Function	UDP phosphatase activity	IBA
GO:0070062	Component	Extracellular exosome	HDA	23533145

MIM	HGNC	e!Ensembl
602012	3364	ENSG00000054179

Q9Y5L3

Protein name

Ectonucleoside triphosphate diphosphohydrolase 2 (NTPDase 2) (EC 3.6.1.-) (CD39 antigen-like 1) (Ecto-ATP diphosphohydrolase 2) (Ecto-ATPDase 2) (Ecto-ATPase 2)

Protein function

In the nervous system, could hydrolyze ATP and other nucleotides to regulate purinergic neurotransmission. Hydrolyzes ADP only to a marginal extent. The order of activity with different substrates is ATP > GTP > CTP = ITP > UTP >> ADP = UDP.

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF01150	GDA1_CD39	32 → 459	GDA1/CD39 (nucleoside phosphatase) family	Family

Tissue specificity

TISSUE SPECIFICITY: Brain, placenta, skeletal muscle, kidney, pancreas, heart, ovary, testis, colon, small intestine, prostate and pancreas. No expression in adult thymus, spleen, lung, liver and peripheral blood leukocytes.

Sequence

MAGKVRSLLPPLLLAAAGLAGLLLLCVPTRDVREPPALKYGIVLDAGSSHTSMFIYKWPA
DKENDTGIVGQHSSCDVPGGGISSYADNPSGASQSLVGCLEQALQDVPKERHAGTPLYLG
ATAGMRLLNLTNPEASTSVLMAVTHTLTQYPFDFRGARILSGQEEGVFGWVTANYLLENF
IKYGWVGRWFRPRKGTLGAMDLGGASTQITFETTSPAEDRASEVQLHLYGQHYRVYTHSF
LCYGRDQVLQRLLASALQTHGFHPCWPRGFSTQVLLGDVYQSPCTMAQRPQNFNSSARVS
LSGSSDPHLCRDLVSGLFSFSSCPFSRCSFNGVFQPPVAGNFVAFSAFFYTVDFLRTSMG
LPVATLQQLEAAAVNVCNQTWAQLQARVPGQRARLADYCAGAMFVQQLLSRGYGFDERAF
GGVIFQKKAADTAVGWALGYMLNLTNLIPADPPGLRKGTDFSSWVVLLLLFASALLAALV
LLLRQVHSAKLPSTI

Sequence length

495

Interactions

View interactions

	KEGG		Reactome
	Purine metabolism Metabolic pathways Nucleotide metabolism Taste transduction		Phosphate bond hydrolysis by NTPDase proteins

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (6)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
BILIARY CIRRHOSIS	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Colon adenocarcinoma	Likely benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LIVER CIRRHOSIS, BILIARY	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Lung cancer	Likely benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Malignant lymphoma, large B-cell, diffuse	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PRIMARY BILIARY CHOLANGITIS	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (20)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Alzheimer Disease	Alzheimer disease	Pubtator	25311278	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Biliary cirrhosis	Biliary cirrhosis	LHGDN	15651265		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Biliary cirrhosis	Biliary cirrhosis	CTD_human_DG	15651265		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Biliary Cirrhosis, Primary, 1	Biliary cirrhosis	CTD_human_DG	15651265		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	28894087, 33188160	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cardiomyopathy Dilated	Dilated cardiomyopathy	Pubtator	36401332	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Fibrosis, Liver	Liver Fibrosis	BEFREE	29134411		★★★★★ ★☆☆☆☆ Found in Text Mining only
Heart Failure	Heart failure	Pubtator	36401332	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypoxia	Hypoxia	Pubtator	28894087	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	28894087		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of pancreas	Pancreatic cancer	BEFREE	16920697		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	28894087		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	28894087		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatic carcinoma	Pancreatic carcinoma	BEFREE	16920697		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasms	Pancreatic neoplasm	Pubtator	16920697	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatitis Chronic	Pancreatitis	Pubtator	16920697	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Primary biliary cirrhosis	Biliary Cirrhosis	CTD_human_DG	15651265		★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	34209090	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Schizophrenia	Schizophrenia	Pubtator	25522406	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Secondary Biliary Cholangitis	Biliary Cholangitis	CTD_human_DG	15651265		★★★★★ ★☆☆☆☆ Found in Text Mining only

ENTPD2 (ectonucleoside triphosphate diphosphohydrolase 2)