GMFG (glia maturation factor gamma)

Gene

• Entrez ID: 9535
• Gene name: Glia maturation factor gamma
• Gene symbol: GMFG
• Synonyms (NCBI Gene): GMF-GAMMA
• Chromosome: 19
• Chromosome location: 19q13.2

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT1022676	hsa-miR-2355-5p	CLIP-seq
MIRT1022677	hsa-miR-3691-3p	CLIP-seq
MIRT1022678	hsa-miR-4704-3p	CLIP-seq

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0003779	Function	Actin binding	IEA
GO:0004860	Function	Protein kinase inhibitor activity	TAS	8639570
GO:0005576	Component	Extracellular region	TAS
GO:0006468	Process	Protein phosphorylation	TAS	7598724
GO:0007165	Process	Signal transduction	IEA
GO:0008047	Function	Enzyme activator activity	TAS	8798479
GO:0008083	Function	Growth factor activity	IEA
GO:0030864	Component	Cortical actin cytoskeleton	IBA
GO:0034316	Process	Negative regulation of Arp2/3 complex-mediated actin nucleation	IBA
GO:0034316	Process	Negative regulation of Arp2/3 complex-mediated actin nucleation	IEA
GO:0034774	Component	Secretory granule lumen	TAS
GO:0071846	Process	Actin filament debranching	IBA
GO:0071846	Process	Actin filament debranching	IEA
GO:0071846	Process	Actin filament debranching	IEA
GO:0071933	Function	Arp2/3 complex binding	IBA
GO:0071933	Function	Arp2/3 complex binding	IEA
GO:1904813	Component	Ficolin-1-rich granule lumen	TAS

Other IDs

• MIM: 604104
• HGNC: 4374
• e!Ensembl: ENSG00000130755

Protein

• UniProt ID: O60234
• Protein name: Glia maturation factor gamma (GMF-gamma)
• PDB: 3L50
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00241	Cofilin_ADF	14 → 137	Cofilin/tropomyosin-type actin-binding protein	Domain

• Tissue specificity: TISSUE SPECIFICITY: Expressed predominantly in lung, heart and placenta.
• Sequence:

  MSDSLVVCEVDPELTEKLRKFRFRKETDNAAIIMKVDKDRQMVVLEEEFQNISPEELKME
  LPERQPRFVVYSYKYVHDDGRVSYPLCFIFSSPVGCKPEQQMMYAGSKNRLVQTAELTKV
  FEIRTTDDLTEAWLQEKLSFFR

• Sequence length: 142

Pathways

Reactome:

Neutrophil degranulation

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
DYSLEXIA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LIVER CIRRHOSIS, EXPERIMENTAL	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LUNG ADENOCARCINOMA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Bile Duct Neoplasms	Bile duct neoplasms	Pubtator	33863293	Associate	★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	35103856, 37287069, 37551622	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Renal Cell	Renal cell carcinoma	Pubtator	33863293	Stimulate	★☆☆☆☆ Found in Text Mining only
Carcinoma Squamous Cell	Squamous cell carcinoma	Pubtator	33863293	Inhibit	★☆☆☆☆ Found in Text Mining only
Carcinoma, Ovarian Epithelial	Ovarian Epithelial carcinoma	BEFREE	24486602		★☆☆☆☆ Found in Text Mining only
Cardiovascular Diseases	Cardiovascular Diseases	BEFREE	16873721		★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	28075454		★☆☆☆☆ Found in Text Mining only
Coronary Arteriosclerosis	Coronary Arteriosclerosis	BEFREE	16873721		★☆☆☆☆ Found in Text Mining only
Epithelial ovarian cancer	Ovarian cancer	BEFREE	24486602		★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	Pubtator	33863293	Stimulate	★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	Pubtator	39184354	Associate	★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	Pubtator	33863293	Stimulate	★☆☆☆☆ Found in Text Mining only
Kidney Diseases	Kidney disease	Pubtator	33863293	Inhibit	★☆☆☆☆ Found in Text Mining only
Leukemia Myeloid Acute	Myeloid leukemia	Pubtator	33863293	Stimulate	★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung neoplasms	Pubtator	35383531, 37679517	Inhibit	★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic metastasis	Pubtator	37372337	Associate	★☆☆☆☆ Found in Text Mining only
Melanoma	Melanoma	Pubtator	33863293	Associate	★☆☆☆☆ Found in Text Mining only
Metabolic Diseases	Metabolic Diseases	BEFREE	30971398		★☆☆☆☆ Found in Text Mining only
Myocardial Ischemia	Myocardial Ischemia	BEFREE	16873721		★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasms	Pancreatic neoplasm	Pubtator	33863293	Stimulate	★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	33863293	Associate	★☆☆☆☆ Found in Text Mining only
Testicular Germ Cell Tumor	Testicular germ cell tumor	Pubtator	33863293	Stimulate	★☆☆☆☆ Found in Text Mining only
Testicular Neoplasms	Testicular neoplasm	Pubtator	33863293	Stimulate	★☆☆☆☆ Found in Text Mining only
Triple Negative Breast Neoplasms	Triple negative breast cancer	Pubtator	37372337	Stimulate	★☆☆☆☆ Found in Text Mining only