Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	9532
Gene name	BAG cochaperone 2
Gene symbol	BAG2
Synonyms (NCBI Gene)	BAG-2dJ417I1.2
Chromosome	6
Chromosome location	6p12.1
Summary	BAG proteins compete with Hip for binding to the Hsc70/Hsp70 ATPase domain and promote substrate release. All the BAG proteins have an approximately 45-amino acid BAG domain near the C terminus but differ markedly in their N-terminal regions. The predicte

164

Show/Hide all (164)

miRTarBase ID	miRNA	Experiments	Reference
MIRT021988	hsa-miR-128-3p	Microarray	17612493
MIRT025092	hsa-miR-181a-5p	Microarray	17612493
MIRT048797	hsa-miR-93-5p	CLASH	23622248
MIRT722359	hsa-miR-6750-3p	HITS-CLIP	19536157
MIRT021988	hsa-miR-128-3p	HITS-CLIP	19536157
MIRT722358	hsa-miR-216a-3p	HITS-CLIP	19536157
MIRT722356	hsa-miR-3681-3p	HITS-CLIP	19536157
MIRT722357	hsa-miR-130b-5p	HITS-CLIP	19536157
MIRT722355	hsa-miR-627-3p	HITS-CLIP	19536157
MIRT722354	hsa-miR-513a-5p	HITS-CLIP	19536157
MIRT722353	hsa-miR-27a-3p	HITS-CLIP	19536157
MIRT722352	hsa-miR-27b-3p	HITS-CLIP	19536157
MIRT722351	hsa-miR-6883-3p	HITS-CLIP	19536157
MIRT722349	hsa-miR-4755-5p	HITS-CLIP	19536157
MIRT722350	hsa-miR-5006-3p	HITS-CLIP	19536157
MIRT722348	hsa-miR-4446-5p	HITS-CLIP	19536157
MIRT628697	hsa-miR-339-5p	HITS-CLIP	23824327
MIRT628696	hsa-miR-486-5p	HITS-CLIP	23824327
MIRT628695	hsa-miR-214-5p	HITS-CLIP	23824327
MIRT628694	hsa-miR-6811-3p	HITS-CLIP	23824327
MIRT628693	hsa-miR-6847-3p	HITS-CLIP	23824327
MIRT628692	hsa-miR-6514-3p	HITS-CLIP	23824327
MIRT448985	hsa-miR-6507-3p	PAR-CLIP	22100165
MIRT448984	hsa-miR-142-5p	PAR-CLIP	22100165
MIRT448983	hsa-miR-5590-3p	PAR-CLIP	22100165
MIRT448982	hsa-miR-5002-5p	PAR-CLIP	22100165
MIRT448981	hsa-miR-4328	PAR-CLIP	22100165
MIRT448980	hsa-miR-223-3p	PAR-CLIP	22100165
MIRT448979	hsa-miR-5004-3p	PAR-CLIP	22100165
MIRT733414	hsa-miR-1303	qRT-PCRWestern blotting	34212217
MIRT722359	hsa-miR-6750-3p	HITS-CLIP	19536157
MIRT021988	hsa-miR-128-3p	HITS-CLIP	19536157
MIRT722358	hsa-miR-216a-3p	HITS-CLIP	19536157
MIRT722356	hsa-miR-3681-3p	HITS-CLIP	19536157
MIRT722357	hsa-miR-130b-5p	HITS-CLIP	19536157
MIRT722355	hsa-miR-627-3p	HITS-CLIP	19536157
MIRT722354	hsa-miR-513a-5p	HITS-CLIP	19536157
MIRT722353	hsa-miR-27a-3p	HITS-CLIP	19536157
MIRT722352	hsa-miR-27b-3p	HITS-CLIP	19536157
MIRT722351	hsa-miR-6883-3p	HITS-CLIP	19536157
MIRT722349	hsa-miR-4755-5p	HITS-CLIP	19536157
MIRT722350	hsa-miR-5006-3p	HITS-CLIP	19536157
MIRT722348	hsa-miR-4446-5p	HITS-CLIP	19536157
MIRT628697	hsa-miR-339-5p	HITS-CLIP	23824327
MIRT628696	hsa-miR-486-5p	HITS-CLIP	23824327
MIRT628695	hsa-miR-214-5p	HITS-CLIP	23824327
MIRT628694	hsa-miR-6811-3p	HITS-CLIP	23824327
MIRT628693	hsa-miR-6847-3p	HITS-CLIP	23824327
MIRT628692	hsa-miR-6514-3p	HITS-CLIP	23824327
MIRT448985	hsa-miR-6507-3p	PAR-CLIP	22100165
MIRT448984	hsa-miR-142-5p	PAR-CLIP	22100165
MIRT448983	hsa-miR-5590-3p	PAR-CLIP	22100165
MIRT448982	hsa-miR-5002-5p	PAR-CLIP	22100165
MIRT448981	hsa-miR-4328	PAR-CLIP	22100165
MIRT448980	hsa-miR-223-3p	PAR-CLIP	22100165
MIRT448979	hsa-miR-5004-3p	PAR-CLIP	22100165
MIRT814536	hsa-miR-3121-3p	CLIP-seq
MIRT814537	hsa-miR-3670	CLIP-seq
MIRT814538	hsa-miR-382	CLIP-seq
MIRT1940791	hsa-miR-223	CLIP-seq
MIRT1940792	hsa-miR-2355-5p	CLIP-seq
MIRT1940793	hsa-miR-3074-3p	CLIP-seq
MIRT814536	hsa-miR-3121-3p	CLIP-seq
MIRT814537	hsa-miR-3670	CLIP-seq
MIRT814538	hsa-miR-382	CLIP-seq
MIRT1940794	hsa-miR-4286	CLIP-seq
MIRT1940795	hsa-miR-4697-3p	CLIP-seq
MIRT1940796	hsa-miR-548an	CLIP-seq
MIRT1940797	hsa-miR-568	CLIP-seq
MIRT1940798	hsa-miR-578	CLIP-seq
MIRT1940799	hsa-miR-643	CLIP-seq
MIRT2179818	hsa-miR-1229	CLIP-seq
MIRT2179819	hsa-miR-1323	CLIP-seq
MIRT1940791	hsa-miR-223	CLIP-seq
MIRT2179820	hsa-miR-23a	CLIP-seq
MIRT2179821	hsa-miR-23b	CLIP-seq
MIRT2179822	hsa-miR-23c	CLIP-seq
MIRT2179823	hsa-miR-342-3p	CLIP-seq
MIRT1940795	hsa-miR-4697-3p	CLIP-seq
MIRT2179824	hsa-miR-4699-5p	CLIP-seq
MIRT2179825	hsa-miR-4719	CLIP-seq
MIRT2179826	hsa-miR-513b	CLIP-seq
MIRT2179827	hsa-miR-548a-3p	CLIP-seq
MIRT2179828	hsa-miR-548e	CLIP-seq
MIRT2179829	hsa-miR-548f	CLIP-seq
MIRT2179830	hsa-miR-548o	CLIP-seq
MIRT2179831	hsa-miR-876-3p	CLIP-seq
MIRT2426602	hsa-miR-128	CLIP-seq
MIRT2426603	hsa-miR-27a	CLIP-seq
MIRT2426604	hsa-miR-27b	CLIP-seq
MIRT2426605	hsa-miR-2861	CLIP-seq
MIRT2426606	hsa-miR-410	CLIP-seq
MIRT2426607	hsa-miR-4420	CLIP-seq
MIRT2426608	hsa-miR-4731-5p	CLIP-seq
MIRT2426609	hsa-miR-4760-3p	CLIP-seq
MIRT2426610	hsa-miR-4789-5p	CLIP-seq
MIRT2179831	hsa-miR-876-3p	CLIP-seq
MIRT2426602	hsa-miR-128	CLIP-seq
MIRT2483242	hsa-miR-140-5p	CLIP-seq
MIRT2483243	hsa-miR-141	CLIP-seq
MIRT2483244	hsa-miR-186	CLIP-seq
MIRT2483245	hsa-miR-200a	CLIP-seq
MIRT2483246	hsa-miR-2052	CLIP-seq
MIRT2483247	hsa-miR-2053	CLIP-seq
MIRT2483248	hsa-miR-2113	CLIP-seq
MIRT1940793	hsa-miR-3074-3p	CLIP-seq
MIRT2483249	hsa-miR-3123	CLIP-seq
MIRT2483250	hsa-miR-3133	CLIP-seq
MIRT2483251	hsa-miR-3144-3p	CLIP-seq
MIRT2483252	hsa-miR-325	CLIP-seq
MIRT2483253	hsa-miR-338-5p	CLIP-seq
MIRT2483254	hsa-miR-3925-5p	CLIP-seq
MIRT2483255	hsa-miR-3978	CLIP-seq
MIRT2483256	hsa-miR-4302	CLIP-seq
MIRT2483257	hsa-miR-4310	CLIP-seq
MIRT2483258	hsa-miR-4503	CLIP-seq
MIRT2483259	hsa-miR-4511	CLIP-seq
MIRT2483260	hsa-miR-4720-3p	CLIP-seq
MIRT2483261	hsa-miR-4771	CLIP-seq
MIRT2483262	hsa-miR-4804-3p	CLIP-seq
MIRT2483263	hsa-miR-494	CLIP-seq
MIRT2483264	hsa-miR-495	CLIP-seq
MIRT2483265	hsa-miR-499a-5p	CLIP-seq
MIRT2483266	hsa-miR-505	CLIP-seq
MIRT2483267	hsa-miR-520f	CLIP-seq
MIRT2483268	hsa-miR-539	CLIP-seq
MIRT2483269	hsa-miR-548ag	CLIP-seq
MIRT2483270	hsa-miR-548ai	CLIP-seq
MIRT1940796	hsa-miR-548an	CLIP-seq
MIRT2483271	hsa-miR-549	CLIP-seq
MIRT1940798	hsa-miR-578	CLIP-seq
MIRT2483272	hsa-miR-580	CLIP-seq
MIRT2483273	hsa-miR-586	CLIP-seq
MIRT2483274	hsa-miR-590-3p	CLIP-seq
MIRT2483275	hsa-miR-628-3p	CLIP-seq
MIRT2483276	hsa-miR-758	CLIP-seq
MIRT2483277	hsa-miR-875-5p	CLIP-seq
MIRT2483278	hsa-miR-892a	CLIP-seq
MIRT2426602	hsa-miR-128	CLIP-seq
MIRT2483243	hsa-miR-141	CLIP-seq
MIRT2483244	hsa-miR-186	CLIP-seq
MIRT2483245	hsa-miR-200a	CLIP-seq
MIRT2483246	hsa-miR-2052	CLIP-seq
MIRT2483247	hsa-miR-2053	CLIP-seq
MIRT2483248	hsa-miR-2113	CLIP-seq
MIRT1940793	hsa-miR-3074-3p	CLIP-seq
MIRT2483250	hsa-miR-3133	CLIP-seq
MIRT2483252	hsa-miR-325	CLIP-seq
MIRT2483255	hsa-miR-3978	CLIP-seq
MIRT2483257	hsa-miR-4310	CLIP-seq
MIRT2483258	hsa-miR-4503	CLIP-seq
MIRT2483260	hsa-miR-4720-3p	CLIP-seq
MIRT2483261	hsa-miR-4771	CLIP-seq
MIRT2483262	hsa-miR-4804-3p	CLIP-seq
MIRT2483265	hsa-miR-499a-5p	CLIP-seq
MIRT2483267	hsa-miR-520f	CLIP-seq
MIRT2483269	hsa-miR-548ag	CLIP-seq
MIRT2483270	hsa-miR-548ai	CLIP-seq
MIRT1940796	hsa-miR-548an	CLIP-seq
MIRT2483271	hsa-miR-549	CLIP-seq
MIRT1940798	hsa-miR-578	CLIP-seq
MIRT2483275	hsa-miR-628-3p	CLIP-seq
MIRT2483276	hsa-miR-758	CLIP-seq
MIRT2483278	hsa-miR-892a	CLIP-seq

Show/Hide all (2)

Transcription factor	Regulation	Reference
MYC	Unknown	22146591
SP1	Unknown	22146591

Show/Hide all (34)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000774	Function	Adenyl-nucleotide exchange factor activity	IBA
GO:0000774	Function	Adenyl-nucleotide exchange factor activity	IDA	24318877
GO:0000774	Function	Adenyl-nucleotide exchange factor activity	IEA
GO:0005515	Function	Protein binding	IPI	16207813, 18457437, 22365833, 22810586, 24318877, 24510904, 24981860, 25036637, 25852190, 25959826, 26496610, 29513927, 29568061, 30021884, 31980649, 32296183, 32814053, 33961781, 35167623, 35271311, 37045861
GO:0005829	Component	Cytosol	TAS
GO:0005874	Component	Microtubule	IEA
GO:0005874	Component	Microtubule	ISS	19228967
GO:0006457	Process	Protein folding	TAS	9873016
GO:0010954	Process	Positive regulation of protein processing	IMP	16207813
GO:0019538	Process	Protein metabolic process	IDA	9873015
GO:0030424	Component	Axon	IEA
GO:0030424	Component	Axon	ISS	19228967
GO:0030425	Component	Dendrite	IEA
GO:0030425	Component	Dendrite	ISS	19228967
GO:0031072	Function	Heat shock protein binding	IEA
GO:0031397	Process	Negative regulation of protein ubiquitination	IDA	24383081, 25006867
GO:0031397	Process	Negative regulation of protein ubiquitination	IEA
GO:0031397	Process	Negative regulation of protein ubiquitination	ISS	19228967
GO:0031625	Function	Ubiquitin protein ligase binding	IEA
GO:0032436	Process	Positive regulation of proteasomal ubiquitin-dependent protein catabolic process	ISS	19228967
GO:0042802	Function	Identical protein binding	IPI	22365833, 25036637, 25416956
GO:0044325	Function	Transmembrane transporter binding	IPI	16207813
GO:0045862	Process	Positive regulation of proteolysis	IEA
GO:0048156	Function	Tau protein binding	IEA
GO:0048156	Function	Tau protein binding	NAS	28386764
GO:0050821	Process	Protein stabilization	IBA
GO:0050821	Process	Protein stabilization	IDA	16207813, 24383081, 25006867
GO:0051087	Function	Protein-folding chaperone binding	IEA
GO:0051087	Function	Protein-folding chaperone binding	IPI	16207813
GO:0101031	Component	Protein folding chaperone complex	IPI	16207813
GO:1901588	Component	Dendritic microtubule	IEA
GO:1901588	Component	Dendritic microtubule	ISS	19228967
GO:1901800	Process	Positive regulation of proteasomal protein catabolic process	IEA
GO:1901800	Process	Positive regulation of proteasomal protein catabolic process	ISS	19228967

MIM	HGNC	e!Ensembl
603882	938	ENSG00000112208

O95816

Protein name

BAG family molecular chaperone regulator 2 (BAG-2) (Bcl-2-associated athanogene 2)

Protein function

Co-chaperone for HSP70 and HSC70 chaperone proteins. Acts as a nucleotide-exchange factor (NEF) promoting the release of ADP from the HSP70 and HSC70 proteins thereby triggering client/substrate protein release (PubMed:24318877, PubMed:9873016).

Family and domains

Sequence

MAQAKINAKANEGRFCRSSSMADRSSRLLESLDQLELRVEALREAATAVEQEKEILLEMI
HSIQNSQDMRQISDGEREELNLTANRLMGRTLTVEVSVETIRNPQQQESLKHATRIIDEV
VNKFLDDLGNAKSHLMSLYSACSSEVPHGPVDQKFQSIVIGCALEDQKKIKRRLETLLRN
IENSDKAIKLLEHSKGAGSKTLQQNAESRFN

Sequence length

211

Interactions

View interactions

	KEGG		Reactome
	Protein processing in endoplasmic reticulum		Regulation of HSF1-mediated heat shock response

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (1)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
CARPENTER SYNDROME 1	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (13)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
B-Cell Lymphomas	B-Cell Lymphoma	BEFREE	29541244		★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	29212038	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	34257542	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Renal Cell	Renal cell carcinoma	Pubtator	23428843	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lip and Oral Cavity Carcinoma	Lip and Oral Cavity Carcinoma	BEFREE	31055249		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liposarcoma	Liposarcoma	Pubtator	39366981	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of mouth	Malignant neoplasm of mouth	BEFREE	31055249		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mesothelioma Malignant	Mesothelioma	Pubtator	33800494	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	26271008		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	BEFREE	25985852		★★★★★ ★☆☆☆☆ Found in Text Mining only
Thyroid Neoplasms	Thyroid cancer	Pubtator	18660828	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Triple Negative Breast Neoplasms	Triple Negative Breast Neoplasms	BEFREE	29212038		★★★★★ ★☆☆☆☆ Found in Text Mining only
Triple Negative Breast Neoplasms	Triple negative breast cancer	Pubtator	29212038	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only

BAG2 (BAG cochaperone 2)