CD38 (CD38 molecule)

Gene

• Entrez ID: 952
• Gene name: CD38 molecule
• Gene symbol: CD38
• Synonyms (NCBI Gene): ADPRC 1, ADPRC1, cADPR1
• Chromosome: 4
• Chromosome location: 4p15.32
• Summary: The protein encoded by this gene is a non-lineage-restricted, type II transmembrane glycoprotein that synthesizes and hydrolyzes cyclic adenosine 5`-diphosphate-ribose, an intracellular calcium ion mobilizing messenger. The release of soluble protein and

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT018938	hsa-miR-335-5p	Microarray	18185580
MIRT053006	hsa-miR-140-3p	Luciferase reporter assay, qRT-PCR	22773691
MIRT504921	hsa-miR-5692a	PAR-CLIP	21572407
MIRT504920	hsa-miR-3613-3p	PAR-CLIP	21572407
MIRT504919	hsa-miR-203a-5p	PAR-CLIP	21572407
MIRT504918	hsa-miR-1273g-5p	PAR-CLIP	21572407
MIRT504917	hsa-miR-19a-5p	PAR-CLIP	21572407
MIRT504916	hsa-miR-19b-1-5p	PAR-CLIP	21572407
MIRT504915	hsa-miR-19b-2-5p	PAR-CLIP	21572407
MIRT504913	hsa-miR-5590-5p	PAR-CLIP	21572407
MIRT504914	hsa-miR-4659a-5p	PAR-CLIP	21572407
MIRT504912	hsa-miR-4659b-5p	PAR-CLIP	21572407
MIRT504911	hsa-miR-218-1-3p	PAR-CLIP	21572407
MIRT504910	hsa-miR-4776-3p	PAR-CLIP	21572407
MIRT504909	hsa-miR-659-3p	PAR-CLIP	21572407
MIRT504921	hsa-miR-5692a	PAR-CLIP	23446348
MIRT504920	hsa-miR-3613-3p	PAR-CLIP	23446348
MIRT504919	hsa-miR-203a-5p	PAR-CLIP	23446348
MIRT504918	hsa-miR-1273g-5p	PAR-CLIP	23446348
MIRT504917	hsa-miR-19a-5p	PAR-CLIP	23446348
MIRT504916	hsa-miR-19b-1-5p	PAR-CLIP	23446348
MIRT504915	hsa-miR-19b-2-5p	PAR-CLIP	23446348
MIRT504913	hsa-miR-5590-5p	PAR-CLIP	23446348
MIRT504914	hsa-miR-4659a-5p	PAR-CLIP	23446348
MIRT504912	hsa-miR-4659b-5p	PAR-CLIP	23446348
MIRT504911	hsa-miR-218-1-3p	PAR-CLIP	23446348
MIRT504910	hsa-miR-4776-3p	PAR-CLIP	23446348
MIRT504909	hsa-miR-659-3p	PAR-CLIP	23446348
MIRT504921	hsa-miR-5692a	PAR-CLIP	23446348
MIRT504920	hsa-miR-3613-3p	PAR-CLIP	23446348
MIRT504919	hsa-miR-203a-5p	PAR-CLIP	23446348
MIRT504918	hsa-miR-1273g-5p	PAR-CLIP	23446348
MIRT504917	hsa-miR-19a-5p	PAR-CLIP	23446348
MIRT504916	hsa-miR-19b-1-5p	PAR-CLIP	23446348
MIRT504915	hsa-miR-19b-2-5p	PAR-CLIP	23446348
MIRT504913	hsa-miR-5590-5p	PAR-CLIP	23446348
MIRT504914	hsa-miR-4659a-5p	PAR-CLIP	23446348
MIRT504912	hsa-miR-4659b-5p	PAR-CLIP	23446348
MIRT504911	hsa-miR-218-1-3p	PAR-CLIP	23446348
MIRT504910	hsa-miR-4776-3p	PAR-CLIP	23446348
MIRT504909	hsa-miR-659-3p	PAR-CLIP	23446348
MIRT734721	hsa-miR-26a-5p	Luciferase reporter assay, Western blotting, Immunoprecipitaion (IP), qRT-PCR, ELISA	31907356
MIRT053006	hsa-miR-140-3p	Western blotting	33121100
MIRT736433	hsa-miR-26b-5p	Luciferase reporter assay, Western blotting, Immunoprecipitaion (IP), qRT-PCR, ELISA	31907356
MIRT504921	hsa-miR-5692a	PAR-CLIP	21572407
MIRT504920	hsa-miR-3613-3p	PAR-CLIP	21572407
MIRT504919	hsa-miR-203a-5p	PAR-CLIP	21572407
MIRT504918	hsa-miR-1273g-5p	PAR-CLIP	21572407
MIRT504917	hsa-miR-19a-5p	PAR-CLIP	21572407
MIRT504916	hsa-miR-19b-1-5p	PAR-CLIP	21572407
MIRT504915	hsa-miR-19b-2-5p	PAR-CLIP	21572407
MIRT504913	hsa-miR-5590-5p	PAR-CLIP	21572407
MIRT504914	hsa-miR-4659a-5p	PAR-CLIP	21572407
MIRT504912	hsa-miR-4659b-5p	PAR-CLIP	21572407
MIRT504911	hsa-miR-218-1-3p	PAR-CLIP	21572407
MIRT504910	hsa-miR-4776-3p	PAR-CLIP	21572407
MIRT504909	hsa-miR-659-3p	PAR-CLIP	21572407
MIRT504921	hsa-miR-5692a	PAR-CLIP	23446348
MIRT504920	hsa-miR-3613-3p	PAR-CLIP	23446348
MIRT504919	hsa-miR-203a-5p	PAR-CLIP	23446348
MIRT504918	hsa-miR-1273g-5p	PAR-CLIP	23446348
MIRT504917	hsa-miR-19a-5p	PAR-CLIP	23446348
MIRT504916	hsa-miR-19b-1-5p	PAR-CLIP	23446348
MIRT504915	hsa-miR-19b-2-5p	PAR-CLIP	23446348
MIRT504913	hsa-miR-5590-5p	PAR-CLIP	23446348
MIRT504914	hsa-miR-4659a-5p	PAR-CLIP	23446348
MIRT504912	hsa-miR-4659b-5p	PAR-CLIP	23446348
MIRT504911	hsa-miR-218-1-3p	PAR-CLIP	23446348
MIRT504910	hsa-miR-4776-3p	PAR-CLIP	23446348
MIRT504909	hsa-miR-659-3p	PAR-CLIP	23446348
MIRT504921	hsa-miR-5692a	PAR-CLIP	23446348
MIRT504920	hsa-miR-3613-3p	PAR-CLIP	23446348
MIRT504919	hsa-miR-203a-5p	PAR-CLIP	23446348
MIRT504918	hsa-miR-1273g-5p	PAR-CLIP	23446348
MIRT504917	hsa-miR-19a-5p	PAR-CLIP	23446348
MIRT504916	hsa-miR-19b-1-5p	PAR-CLIP	23446348
MIRT504915	hsa-miR-19b-2-5p	PAR-CLIP	23446348
MIRT504913	hsa-miR-5590-5p	PAR-CLIP	23446348
MIRT504914	hsa-miR-4659a-5p	PAR-CLIP	23446348
MIRT504912	hsa-miR-4659b-5p	PAR-CLIP	23446348
MIRT504911	hsa-miR-218-1-3p	PAR-CLIP	23446348
MIRT504910	hsa-miR-4776-3p	PAR-CLIP	23446348
MIRT504909	hsa-miR-659-3p	PAR-CLIP	23446348
MIRT1959493	hsa-miR-1226	CLIP-seq
MIRT1959494	hsa-miR-214	CLIP-seq
MIRT1959495	hsa-miR-3130-3p	CLIP-seq
MIRT1959496	hsa-miR-3194-3p	CLIP-seq
MIRT1959497	hsa-miR-3619-5p	CLIP-seq
MIRT1959498	hsa-miR-4530	CLIP-seq
MIRT1959499	hsa-miR-4793-3p	CLIP-seq
MIRT1959500	hsa-miR-634	CLIP-seq
MIRT1959501	hsa-miR-761	CLIP-seq
MIRT1959502	hsa-miR-767-5p	CLIP-seq
MIRT2499500	hsa-miR-3137	CLIP-seq
MIRT2499501	hsa-miR-3202	CLIP-seq
MIRT2499502	hsa-miR-4476	CLIP-seq
MIRT2499503	hsa-miR-4670-3p	CLIP-seq
MIRT2499504	hsa-miR-584	CLIP-seq
MIRT2499505	hsa-miR-591	CLIP-seq

Transcription factors

Transcription factor	Regulation	Reference
MYC	Activation	11519042
NFKB1	Unknown	17322278;18341691;18441094
RELA	Unknown	17322278;18341691;18441094

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001666	Process	Response to hypoxia	IEA
GO:0005886	Component	Plasma membrane	IBA
GO:0005886	Component	Plasma membrane	IDA
GO:0005886	Component	Plasma membrane	TAS	8253715
GO:0007165	Process	Signal transduction	NAS	8253715
GO:0007204	Process	Positive regulation of cytosolic calcium ion concentration	IEA
GO:0007565	Process	Female pregnancy	IEA
GO:0008284	Process	Positive regulation of cell population proliferation	IEA
GO:0009410	Process	Response to xenobiotic stimulus	IMP	17875758
GO:0009725	Process	Response to hormone	IEA
GO:0009986	Component	Cell surface	IEA
GO:0010977	Process	Negative regulation of neuron projection development	IEA
GO:0014824	Process	Artery smooth muscle contraction	IEA
GO:0016020	Component	Membrane	IEA
GO:0016020	Component	Membrane	TAS	8253715
GO:0016323	Component	Basolateral plasma membrane	IEA
GO:0016740	Function	Transferase activity	IEA
GO:0016787	Function	Hydrolase activity	IEA
GO:0016798	Function	Hydrolase activity, acting on glycosyl bonds	IEA
GO:0016849	Function	Phosphorus-oxygen lyase activity	IBA
GO:0016849	Function	Phosphorus-oxygen lyase activity	IEA
GO:0019674	Process	NAD+ metabolic process	TAS
GO:0030307	Process	Positive regulation of cell growth	IEA
GO:0030890	Process	Positive regulation of B cell proliferation	IBA
GO:0030890	Process	Positive regulation of B cell proliferation	IEA
GO:0030890	Process	Positive regulation of B cell proliferation	IMP	17875758
GO:0031965	Component	Nuclear membrane	IEA
GO:0032024	Process	Positive regulation of insulin secretion	IEA
GO:0032355	Process	Response to estradiol	IEA
GO:0032526	Process	Response to retinoic acid	IEA
GO:0032570	Process	Response to progesterone	IEA
GO:0033194	Process	Response to hydroperoxide	IEA
GO:0034097	Process	Response to cytokine	IEA
GO:0042100	Process	B cell proliferation	IEA
GO:0042802	Function	Identical protein binding	IEA
GO:0043066	Process	Negative regulation of apoptotic process	IMP	17875758
GO:0045779	Process	Negative regulation of bone resorption	IEA
GO:0045892	Process	Negative regulation of DNA-templated transcription	IMP	17875758
GO:0045893	Process	Positive regulation of DNA-templated transcription	IMP	17875758
GO:0045907	Process	Positive regulation of vasoconstriction	IEA
GO:0050853	Process	B cell receptor signaling pathway	IMP	17875758
GO:0060292	Process	Long-term synaptic depression	IEA
GO:0061809	Function	NAD+ nucleosidase activity, cyclic ADP-ribose generating	IEA
GO:0061809	Function	NAD+ nucleosidase activity, cyclic ADP-ribose generating	TAS
GO:0070062	Component	Extracellular exosome	HDA	23533145
GO:0070555	Process	Response to interleukin-1	IEA
GO:0097190	Process	Apoptotic signaling pathway	TAS	10777496

Other IDs

• MIM: 107270
• HGNC: 1667
• e!Ensembl: ENSG00000004468

Protein

• UniProt ID: P28907
• Protein name: ADP-ribosyl cyclase/cyclic ADP-ribose hydrolase 1 (EC 3.2.2.-) (EC 3.2.2.6) (2'-phospho-ADP-ribosyl cyclase) (2'-phospho-ADP-ribosyl cyclase/2'-phospho-cyclic-ADP-ribose transferase) (EC 2.4.99.20) (2'-phospho-cyclic-ADP-ribose transferase) (ADP-ribosyl c
• Protein function: Synthesizes cyclic ADP-ribose (cADPR), a second messenger for glucose-induced insulin secretion (PubMed:7961800, PubMed:8253715). Synthesizes the Ca(2+) mobilizer nicotinate-adenine dinucleotide phosphate, NAADP(+), from 2'-phospho-cADPR and nic
• PDB: 1YH3, 1ZVM, 2EF1, 2HCT, 2I65, 2I66, 2I67, 2O3Q, 2O3R, 2O3S, 2O3T, 2O3U, 2PGJ, 2PGL, 3DZF, 3DZG, 3DZH, 3DZI, 3DZJ, 3DZK, 3F6Y, 3I9M, 3I9N, 3OFS, 3RAJ, 3ROK, 3ROM, 3ROP, 3ROQ, 3U4H, 3U4I, 4CMH, 4F45, 4F46, 4OGW, 4TMF, 4XJS, 4XJT, 5F1K, 5F1O, 5F21, 6EDR, 6VUA, 7DHA, 7DUO, 7VKE, 8BYU, 8D0M, 8IL3, 8P8C, 8VAU
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF02267	Rib_hydrolayse	56 → 296	ADP-ribosyl cyclase	Domain

• Tissue specificity: TISSUE SPECIFICITY: Expressed at high levels in pancreas, liver, kidney, brain, testis, ovary, placenta, malignant lymphoma and neuroblastoma. {ECO:0000269|PubMed:8253715, ECO:0000269|PubMed:9074508}.
• Sequence:

  MANCEFSPVSGDKPCCRLSRRAQLCLGVSILVLILVVVLAVVVPRWRQQWSGPGTTKRFP
  ETVLARCVKYTEIHPEMRHVDCQSVWDAFKGAFISKHPCNITEEDYQPLMKLGTQTVPCN
  KILLWSRIKDLAHQFTQVQRDMFTLEDTLLGYLADDLTWCGEFNTSKINYQSCPDWRKDC
  SNNPVSVFWKTVSRRFAEAACDVVHVMLNGSRSKIFDKNSTFGSVEVHNLQPEKVQTLEA
  WVIHGGREDSRDLCQDPTIKELESIISKRNIQFSCKNIYRPDKFLQCVKNPEDSSCTSEI
  

• Sequence length: 300

Pathways

KEGG:

Nicotinate and nicotinamide metabolism
Metabolic pathways
Calcium signaling pathway
Hematopoietic cell lineage
Oxytocin signaling pathway
Salivary secretion
Pancreatic secretion

Reactome:

Nicotinate metabolism

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
DIABETES MELLITUS, INSULIN-DEPENDENT	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DIABETES MELLITUS, NON-INSULIN-DEPENDENT	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LIVER CIRRHOSIS, EXPERIMENTAL	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MYOCARDIAL ISCHEMIA	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Acquired Hypogammaglobulinemia	Common Variable Immunodeficiency	BEFREE	24126614		★☆☆☆☆ Found in Text Mining only
Acute leukemia	Leukemia	BEFREE	10654451, 11477655, 16956826, 22871473, 3876107, 7888665, 8616782, 9010221, 9616163		★☆☆☆☆ Found in Text Mining only
Acute lymphocytic leukemia	Lymphocytic Leukemia	BEFREE	10554802, 10637483, 10654451, 16643437, 24681707, 29118010, 29772458, 30126842, 30466749, 3876107, 7529552, 8207990, 9305606, 9616163		★☆☆☆☆ Found in Text Mining only
Acute Megakaryocytic Leukemias	Megakaryocytic Leukemia	BEFREE	15193441, 25164427		★☆☆☆☆ Found in Text Mining only
Acute monocytic leukemia	Monocytic Leukemia	BEFREE	11809673, 21330473, 22258035, 22289983, 31097000		★☆☆☆☆ Found in Text Mining only
Acute myelomonocytic leukemia	Myelomonocytic Leukemia	BEFREE	12096348, 12555219, 16329108, 7671224, 9160665		★☆☆☆☆ Found in Text Mining only
Acute Promyelocytic Leukemia	Promyelocytic Leukemia	BEFREE	10587705, 10654451, 19477513, 25369030, 29234114, 3478130, 7536493, 7690555		★☆☆☆☆ Found in Text Mining only
Acute Undifferentiated Leukemia	Leukemia	BEFREE	21734239, 25881148, 27611922, 31002948		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma	Adenocarcinoma	BEFREE	29228209		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of lung (disorder)	Lung adenocarcinoma	BEFREE	29228209		★☆☆☆☆ Found in Text Mining only
Adult Acute Lymphocytic Leukemia	Lymphocytic Leukemia	BEFREE	10654451, 24681707, 29772458, 30466749, 9305606, 9616163		★☆☆☆☆ Found in Text Mining only
Adult Diffuse Large B-Cell Lymphoma	B-cell Lymphoma	BEFREE	25564959		★☆☆☆☆ Found in Text Mining only
Adult Hodgkin Lymphoma	Hodgkin Lymphoma	BEFREE	30009533		★☆☆☆☆ Found in Text Mining only
Adult T-Cell Lymphoma/Leukemia	T-Cell Lymphoma/Leukemia	BEFREE	8261443		★☆☆☆☆ Found in Text Mining only
Alexander Disease	Alexander Disease	BEFREE	31327963		★☆☆☆☆ Found in Text Mining only
Alveolar Soft Part Sarcoma	Alveolar Sarcoma	BEFREE	11438465, 15952162, 25453902, 30744536		★☆☆☆☆ Found in Text Mining only
Alzheimer Disease	Alzheimer disease	Pubtator	20643858	Stimulate	★☆☆☆☆ Found in Text Mining only
Alzheimer Disease	Alzheimer disease	Pubtator	35279225	Associate	★☆☆☆☆ Found in Text Mining only
Alzheimer disease, familial, type 3	Alzheimer disease	BEFREE	20643858		★☆☆☆☆ Found in Text Mining only
Amnesia	Amnesia	BEFREE	22366648		★☆☆☆☆ Found in Text Mining only
Amyloidosis	Amyloidosis	BEFREE	29577600, 30079070		★☆☆☆☆ Found in Text Mining only
Amyloidosis, familial visceral	Amyloidosis	BEFREE	8704185		★☆☆☆☆ Found in Text Mining only
Anaplasia	Anaplasia	BEFREE	30462553		★☆☆☆☆ Found in Text Mining only
Androgen-Insensitivity Syndrome	Androgen-Insensitivity Syndrome	BEFREE	28742737		★☆☆☆☆ Found in Text Mining only
Anemia	Anemia	Pubtator	10560909	Associate	★☆☆☆☆ Found in Text Mining only
Anemia	Anemia	LHGDN	17287849		★☆☆☆☆ Found in Text Mining only
Anemia Aplastic	Aplastic anemia	Pubtator	8701944	Associate	★☆☆☆☆ Found in Text Mining only
Anemia Hemolytic Autoimmune	Autoimmune hemolytic anemia	Pubtator	10583274	Associate	★☆☆☆☆ Found in Text Mining only
Anemia Sickle Cell	Sickle cell anemia	Pubtator	15145217, 30185656	Associate	★☆☆☆☆ Found in Text Mining only
Anemia, Diamond-Blackfan	Anemia	BEFREE	12718904		★☆☆☆☆ Found in Text Mining only
Anemia, Sickle Cell	Anemia	BEFREE	12032689, 23720018		★☆☆☆☆ Found in Text Mining only
Aneuploidy	Aneuploidy	Pubtator	8695810	Associate	★☆☆☆☆ Found in Text Mining only
Ankylosing spondylitis	Ankylosing Spondylitis	BEFREE	24397353, 29718882		★☆☆☆☆ Found in Text Mining only
ANOPHTHALMIA AND PULMONARY HYPOPLASIA	Syndromic microphthalmia	BEFREE	30689488		★☆☆☆☆ Found in Text Mining only
Anorexia Nervosa	Anorexia nervosa	Pubtator	27483138	Associate	★☆☆☆☆ Found in Text Mining only
Anorexia Nervosa	Anorexia	BEFREE	30819332, 31385420		★☆☆☆☆ Found in Text Mining only
Aortic Aneurysm	Aortic Aneurysm	BEFREE	16476613, 23054244		★☆☆☆☆ Found in Text Mining only
Arthralgia	Arthralgia	Pubtator	29720240	Stimulate	★☆☆☆☆ Found in Text Mining only
Arthritis	Arthritis	Pubtator	29720240	Stimulate	★☆☆☆☆ Found in Text Mining only
Arthritis	Arthritis	BEFREE	30949517, 31085699		★☆☆☆☆ Found in Text Mining only
Arthritis Juvenile	Juvenile arthritis	Pubtator	12562401	Associate	★☆☆☆☆ Found in Text Mining only
Arthritis Rheumatoid	Rheumatoid arthritis	Pubtator	11592364, 12562401, 19886735, 22251373, 27424032, 30327652, 36270740, 39290322, 9665944	Associate	★☆☆☆☆ Found in Text Mining only
Arthritis Rheumatoid	Rheumatoid arthritis	Pubtator	24397353, 29720240	Stimulate	★☆☆☆☆ Found in Text Mining only
Arthritis, Psoriatic	Psoriatic Arthritis	BEFREE	28461105		★☆☆☆☆ Found in Text Mining only
Asthma	Asthma	Pubtator	17322278, 17947510, 18341691, 21469087, 24634087, 40234829	Associate	★☆☆☆☆ Found in Text Mining only
Asthma	Asthma	BEFREE	18341691, 20693316, 24634087, 25594684, 27666020, 27939939, 29576747		★☆☆☆☆ Found in Text Mining only
Ataxia Telangiectasia	Ataxia Telangiectasia	BEFREE	1283320, 1518308, 1913594, 2539641, 8036021		★☆☆☆☆ Found in Text Mining only
Attention Deficit Disorder	Attention Deficit Hyperactivity Disorder	BEFREE	20425388		★☆☆☆☆ Found in Text Mining only
Attention deficit hyperactivity disorder	Attention Deficit Hyperactivity Disorder	BEFREE	20425388		★☆☆☆☆ Found in Text Mining only
Autism Spectrum Disorder	Autism	Pubtator	21528155, 22278094, 27015428, 30886340, 34091402, 38402445	Associate	★☆☆☆☆ Found in Text Mining only
Autism Spectrum Disorders	Autism Spectrum Disorder	BEFREE	20435366, 21182206, 21528155, 21557943, 22227279, 22366648, 24634087, 27015428, 28283809, 28736241, 28848387, 29306053, 30886340, 30896946, 31682209		★☆☆☆☆ Found in Text Mining only
Autistic Disorder	Autism	BEFREE	20435366, 21182206, 22278094, 22366648, 24634087, 26025338, 27603327, 28212520, 28963040		★☆☆☆☆ Found in Text Mining only
Autistic Disorder	Autism	Pubtator	22278094, 24634087, 26371313	Associate	★☆☆☆☆ Found in Text Mining only
Autoimmune Diseases	Autoimmune disease	Pubtator	10583274	Associate	★☆☆☆☆ Found in Text Mining only
Autoimmune Diseases	Autoimmune Diseases	BEFREE	11289039, 12242463, 15505998, 17214095, 26864107, 29463868, 29603313, 30257456, 31085699, 31783629		★☆☆☆☆ Found in Text Mining only
Autoimmune Diseases	Autoimmune disease	Pubtator	17214095	Stimulate	★☆☆☆☆ Found in Text Mining only
Autoimmune Lymphoproliferative Syndrome	Autoimmune lymphoproliferative disorder	Pubtator	31714901	Associate	★☆☆☆☆ Found in Text Mining only
B Acute Lymphoblastic Leukemia with t(9;22)(q34.1;q11.2); BCR-ABL1	Lymphoblastic Leukemia	BEFREE	10654451		★☆☆☆☆ Found in Text Mining only
B-Cell Lymphomas	B-Cell Lymphoma	BEFREE	15258997, 17651861, 19561535, 20678160, 20716805, 24397618, 31778769		★☆☆☆☆ Found in Text Mining only
B-CELL MALIGNANCY, LOW-GRADE	Lymphocytic Leukemia	BEFREE	11843819, 12456497, 15160906, 15590397, 15621833, 15759031, 16198366, 16208411, 16284990, 16332969, 16568475, 16601244, 16825496, 16932341, 17145621, 17344921, 17380202, 17875758, 1913607, 19240243, 19247976, 19298722, 19963136, 26136429		★☆☆☆☆ Found in Text Mining only
beta Thalassemia	beta Thalassemia	BEFREE	11146156		★☆☆☆☆ Found in Text Mining only
Bloch Sulzberger syndrome	Incontinentia pigmenti syndrome	BEFREE	1985463		★☆☆☆☆ Found in Text Mining only
Bone Marrow Diseases	Bone Marrow Diseases	BEFREE	26552643		★☆☆☆☆ Found in Text Mining only
Bone Marrow Diseases	Bone marrow diseases	Pubtator	9136941	Associate	★☆☆☆☆ Found in Text Mining only
Brain Diseases	Brain disease	Pubtator	34091402	Associate	★☆☆☆☆ Found in Text Mining only
Brain Injuries	Brain injuries	Pubtator	34244562	Associate	★☆☆☆☆ Found in Text Mining only
Brain Ischemia	Brain ischemia	Pubtator	34244562	Inhibit	★☆☆☆☆ Found in Text Mining only
Brain Neoplasms	Brain Neoplasms	BEFREE	30159123		★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	16475675, 21028875, 26552643		★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	27762298	Associate	★☆☆☆☆ Found in Text Mining only
Bronchiolitis	Bronchiolitis	BEFREE	29178427		★☆☆☆☆ Found in Text Mining only
Bronchiolitis	Bronchiolitis	Pubtator	29178427	Associate	★☆☆☆☆ Found in Text Mining only
Burkitt Lymphoma	Burkitt lymphoma	Pubtator	25612555, 31484540, 32013131	Associate	★☆☆☆☆ Found in Text Mining only
Burkitt Lymphoma	Burkitt`s Lymphoma	BEFREE	30524421, 31484540, 7836923, 8209868, 9348315		★☆☆☆☆ Found in Text Mining only
Burkitt Lymphoma	Burkitt lymphoma	Pubtator	32497402	Stimulate	★☆☆☆☆ Found in Text Mining only
Carcinoma	Carcinoma	BEFREE	12459622, 20952280		★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	31552039, 32847986, 37377962	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma of lung	Lung carcinoma	BEFREE	22592563, 28573863, 29228209, 30430389		★☆☆☆☆ Found in Text Mining only
Carcinoma, Basal Cell	Carcinoma	BEFREE	16857992		★☆☆☆☆ Found in Text Mining only
Cardiovascular Diseases	Cardiovascular Diseases	BEFREE	27835618, 29415228		★☆☆☆☆ Found in Text Mining only
Cardiovascular Diseases	Cardiovascular disease	Pubtator	34360781	Stimulate	★☆☆☆☆ Found in Text Mining only
Celiac Disease	Celiac disease	Pubtator	27483138, 33654213, 34495570	Associate	★☆☆☆☆ Found in Text Mining only
Celiac Disease	Celiac disease	BEFREE	29903545, 31839959		★☆☆☆☆ Found in Text Mining only
Cerebral Infarction	Ischemic stroke	Pubtator	32785988	Associate	★☆☆☆☆ Found in Text Mining only
Cerebrovascular accident	Stroke	BEFREE	28817801		★☆☆☆☆ Found in Text Mining only
cervical cancer	Cervical Cancer	BEFREE	25310288		★☆☆☆☆ Found in Text Mining only
Cervix carcinoma	Cervix carcinoma	BEFREE	25310288, 28906311		★☆☆☆☆ Found in Text Mining only
Childhood Acute Lymphoblastic Leukemia	Lymphoblastic Leukemia	BEFREE	10654451, 19147788, 24681707, 29772458, 30466749, 9305606, 9616163		★☆☆☆☆ Found in Text Mining only
Childhood Acute Myeloid Leukemia	Acute Myeloid Leukemia	BEFREE	11809673, 12902910, 30624859		★☆☆☆☆ Found in Text Mining only
Chordoma	Chordoma	BEFREE	22002331		★☆☆☆☆ Found in Text Mining only
Christ-Siemens-Touraine syndrome	Hypohidrotic Ectodermal Dysplasia, X-Linked	BEFREE	1864610, 2736795		★☆☆☆☆ Found in Text Mining only
Chronic Disease	Chronic disease	Pubtator	28077069, 37300938	Associate	★☆☆☆☆ Found in Text Mining only
Chronic Lymphocytic Leukemia	Lymphocytic Leukemia	BEFREE	10477712, 10505750, 11807008, 11841407, 11843819, 12149195, 12149224, 12149225, 12393552, 12406914, 12456497, 14557598, 14581416, 15126604, 15160906, 15590397, 15621833, 15759031, 16198366, 16208411, 16284990, 16332969, 16458962, 16529606, 16551848, 16568475, 16601244, 16621959, 16825496, 16932341, 17107912, 17145621, 17287849, 17344921, 17380202, 17391491, 17485110, 17534928, 17786276, 17786715, 17875758, 17928052, 17931624, 17959854, 18006055, 18035414, 18314442, 18326821, 18424664, 18431797, 18499249, 18503580, 18577710, 18587576, 18616755, 18626062, 18759763, 18818986, 18922857, 19021053, 1913607, 19240243, 19247976, 19298722, 19347734, 19438486, 19500131, 19715592, 19789386, 19956559, 19963136, 20086003, 20353271, 20395517, 20425388, 20495622, 20534982, 20546021, 20620972, 20670479, 20817095, 20839337, 21212793, 21417856, 21617698, 21692849, 21765022, 21908424, 21945028, 22171799, 22224978, 22289136, 22320315, 22470559, 22721814, 23052131, 23413591, 23475845, 23494726, 23936412, 24022692, 24286263, 24334759, 24347044, 24421328, 24619633, 24782504, 24829201, 24868078, 24990614, 25030442, 25218362, 25310288, 25891023, 26119874, 26136429, 26306999, 26351937, 27584054, 27637890, 27718514, 28038356, 29091884, 29346066, 29450576, 29463948, 29715621, 29970392, 30064197, 30940652, 8102560		★☆☆☆☆ Found in Text Mining only
Chronic Lymphocytic Leukemia	Lymphocytic Leukemia	LHGDN	12382646, 14749705, 15613544, 17534928, 17684154, 17931624, 18319522, 18403265, 18431797, 18534062, 18689273		★☆☆☆☆ Found in Text Mining only
Chronic Obstructive Airway Disease	Chronic Obstructive Pulmonary Disease	BEFREE	31556347		★☆☆☆☆ Found in Text Mining only
Chronic Periodontitis	Periodontitis	BEFREE	29234752		★☆☆☆☆ Found in Text Mining only
Chronic Periodontitis	Periodontitis	Pubtator	31050915	Associate	★☆☆☆☆ Found in Text Mining only
CNS disorder	CNS Disorder	BEFREE	28937043		★☆☆☆☆ Found in Text Mining only
Cockayne Syndrome, Type I	Cockayne Syndrome	BEFREE	27981803		★☆☆☆☆ Found in Text Mining only
Colitis Ulcerative	Ulcerative colitis	Pubtator	39596612	Associate	★☆☆☆☆ Found in Text Mining only
Coloboma of optic disc	Coloboma of optic disc	BEFREE	9132492		★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	14601650, 29563330		★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	35192548, 39739032	Associate	★☆☆☆☆ Found in Text Mining only
Common Variable Immunodeficiency	Common Variable Immunodeficiency	BEFREE	21041728, 24126614		★☆☆☆☆ Found in Text Mining only
Common Variable Immunodeficiency	Common variable immunodeficiency	Pubtator	33679693, 7554385	Inhibit	★☆☆☆☆ Found in Text Mining only
Compression of spinal cord	Spinal cord compression	BEFREE	12517621, 31439569		★☆☆☆☆ Found in Text Mining only
Cone-Rod Dystrophy 2	Cone-rod dystrophy	BEFREE	29530958		★☆☆☆☆ Found in Text Mining only
Congenital chromosomal disease	Congenital Chromosomal Disease	BEFREE	10086729, 11146574, 11841407, 12034530, 15163010, 15621833, 16652191, 16840733, 16856923, 17391491, 17485110, 17786715, 18223290, 21208658, 21432817, 25445470, 26136429, 26460692, 27742074, 9103213		★☆☆☆☆ Found in Text Mining only
Congenital Fiber Type Disproportion	Congenital myopathy with fiber type disproportion	BEFREE	7908614		★☆☆☆☆ Found in Text Mining only
Congenital sensorineural hearing loss	Congenital Sensorineural Hearing Loss	BEFREE	19028668		★☆☆☆☆ Found in Text Mining only
Congenital thrombotic disease due to Protein C deficiency	Congenital thrombotic thrombocytopenic purpura	Pubtator	27109862	Associate	★☆☆☆☆ Found in Text Mining only
Conventional (Clear Cell) Renal Cell Carcinoma	Renal Carcinoma	BEFREE	10198623, 10484980, 11717438, 12351585, 12469236, 2568884		★☆☆☆☆ Found in Text Mining only
Craniopharyngioma	Craniopharyngioma	Pubtator	40721446	Associate	★☆☆☆☆ Found in Text Mining only
Crohn Disease	Crohn Disease	BEFREE	31179321		★☆☆☆☆ Found in Text Mining only
Degenerative polyarthritis	Arthritis	BEFREE	24397353, 31624962		★☆☆☆☆ Found in Text Mining only
Dementia	Dementia	BEFREE	18581239		★☆☆☆☆ Found in Text Mining only
Depressive disorder	Mental Depression	BEFREE	28300618, 29860184		★☆☆☆☆ Found in Text Mining only
Depressive Disorder	Major depressive disorder	Pubtator	38593939	Associate	★☆☆☆☆ Found in Text Mining only
Dermatitis Atopic	Atopic dermatitis	Pubtator	39196303	Associate	★☆☆☆☆ Found in Text Mining only
Dermatofibrosarcoma Protuberans	Dermatofibrosarcoma Protuberans	BEFREE	10198616		★☆☆☆☆ Found in Text Mining only
Dermoid Cyst	Dermoid Cyst	BEFREE	31504844		★☆☆☆☆ Found in Text Mining only
Diabetes	Diabetes	BEFREE	11289039, 15505998, 18626062, 26025338		★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes Mellitus	BEFREE	11289039, 15505998, 18626062, 26025338		★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes mellitus	Pubtator	32490905, 33230233	Associate	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus Type 1	Diabetes mellitus, type 1	Pubtator	30619245	Associate	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus Type 2	Diabetes mellitus, type 2	Pubtator	27483138	Associate	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Insulin-Dependent	Diabetes Mellitus	BEFREE	15505998, 30619245		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Diabetes Mellitus, Non-Insulin-Dependent	Diabetes Mellitus	BEFREE	11289039, 12242463, 15505998, 9754820		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Diabetes, Autoimmune	Autoimmune Diabetes	BEFREE	29603313		★☆☆☆☆ Found in Text Mining only
Diarrhea	Diarrhea	Pubtator	35589883	Associate	★☆☆☆☆ Found in Text Mining only
Diffuse Large B-Cell Lymphoma	Diffuse Lymphoma	BEFREE	18024371, 18162778, 24397618, 25564959, 30734478		★☆☆☆☆ Found in Text Mining only
Down Syndrome	Down Syndrome	BEFREE	125542		★☆☆☆☆ Found in Text Mining only
Down Syndrome	Down syndrome	Pubtator	18689547	Associate	★☆☆☆☆ Found in Text Mining only
Dwarfism	Dwarfism	BEFREE	11471178		★☆☆☆☆ Found in Text Mining only
Dyskinesias	Dyskinesia	Pubtator	36597662	Associate	★☆☆☆☆ Found in Text Mining only
Dysmorphic features	Dysmorphic Features	BEFREE	2421647		★☆☆☆☆ Found in Text Mining only
Ectodermal Dysplasia	Ectodermal Dysplasia	BEFREE	18060736		★☆☆☆☆ Found in Text Mining only
ECTODERMAL DYSPLASIA 10A, HYPOHIDROTIC/HAIR/NAIL TYPE, AUTOSOMAL DOMINANT	Ectodermal dysplasia	BEFREE	2736795		★☆☆☆☆ Found in Text Mining only
ECTODERMAL DYSPLASIA 10B, HYPOHIDROTIC/HAIR/TOOTH TYPE, AUTOSOMAL RECESSIVE	Ectodermal Dysplasia	BEFREE	2736795		★☆☆☆☆ Found in Text Mining only
ECTODERMAL DYSPLASIA 11A, HYPOHIDROTIC/HAIR/TOOTH TYPE, AUTOSOMAL DOMINANT	Ectodermal dysplasia	BEFREE	2736795		★☆☆☆☆ Found in Text Mining only
ECTODERMAL DYSPLASIA 11B, HYPOHIDROTIC/HAIR/TOOTH TYPE, AUTOSOMAL RECESSIVE	Ectodermal dysplasia	BEFREE	2736795		★☆☆☆☆ Found in Text Mining only
Ectrodactyly	Ectrodactyly	Pubtator	18581239	Associate	★☆☆☆☆ Found in Text Mining only
Encephalitis	Encephalitis	BEFREE	19365854		★☆☆☆☆ Found in Text Mining only
Endometrial Stromal Sarcoma	Endometrial Stromal Sarcoma	BEFREE	22223660, 23959973		★☆☆☆☆ Found in Text Mining only
Ependymoma	Ependymoma	BEFREE	29893620		★☆☆☆☆ Found in Text Mining only
Epilepsy	Epilepsy	BEFREE	28870844		★☆☆☆☆ Found in Text Mining only
Epilepsy	Epilepsy	Pubtator	38164831	Associate	★☆☆☆☆ Found in Text Mining only
Erythropoietic Protoporphyria	Erythropoietic Protoporphyria	BEFREE	19656458		★☆☆☆☆ Found in Text Mining only
Esophageal carcinoma	Esophageal Carcinoma	BEFREE	26294209, 29563330		★☆☆☆☆ Found in Text Mining only
Esophageal Neoplasms	Esophagus Neoplasm	BEFREE	26294209, 29563330		★☆☆☆☆ Found in Text Mining only
Ewings sarcoma	Ewing sarcoma	BEFREE	1373321, 2768519		★☆☆☆☆ Found in Text Mining only
Fanconi Anemia	Fanconi Anemia	BEFREE	21330473		★☆☆☆☆ Found in Text Mining only
FANCONI ANEMIA, COMPLEMENTATION GROUP A (disorder)	Anemia	BEFREE	21330473		★☆☆☆☆ Found in Text Mining only
Fatigue Syndrome Chronic	Fatigue syndrome	Pubtator	26646713, 28275109, 31796045, 38259473	Associate	★☆☆☆☆ Found in Text Mining only
Fatty Liver Disease	Fatty Liver	BEFREE	31465774		★☆☆☆☆ Found in Text Mining only
Fibrosis, Liver	Liver Fibrosis	BEFREE	23555014		★☆☆☆☆ Found in Text Mining only
Gastritis Atrophic	Gastritis	Pubtator	35905420	Stimulate	★☆☆☆☆ Found in Text Mining only
GATA2 Deficiency	Gata2 deficiency	Pubtator	38233570	Associate	★☆☆☆☆ Found in Text Mining only
Giant Cell Fibroblastoma	Giant Cell Fibroblastoma	BEFREE	10198616		★☆☆☆☆ Found in Text Mining only
Glaucoma, Open-Angle	Glaucoma	BEFREE	18161622		★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	BEFREE	30488843		★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	Pubtator	34162860	Associate	★☆☆☆☆ Found in Text Mining only
Glioblastoma Multiforme	Glioblastoma	BEFREE	30488843		★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	Pubtator	31649684	Associate	★☆☆☆☆ Found in Text Mining only
Global developmental delay	Developmental Delay	BEFREE	28295574		★☆☆☆☆ Found in Text Mining only
Glomerulonephritis	Glomerulonephritis	BEFREE	29463868		★☆☆☆☆ Found in Text Mining only
Glomerulonephritis IGA	Iga nephropathy	Pubtator	24219615	Associate	★☆☆☆☆ Found in Text Mining only
Glycogen Storage Disease Type IV	Glycogen storage disease	Pubtator	16098069	Stimulate	★☆☆☆☆ Found in Text Mining only
Glycogen Storage Disease Type VI	Glycogen Storage Disease	BEFREE	28863072		★☆☆☆☆ Found in Text Mining only
Gonadal Dysgenesis	Gonadal Dysgenesis	BEFREE	3742848		★☆☆☆☆ Found in Text Mining only
Graft vs Host Disease	Graft-versus-host disease	Pubtator	25881755, 31442594	Associate	★☆☆☆☆ Found in Text Mining only
Hairy Cell Leukemia	Hairy Cell Leukemia	BEFREE	7985490		★☆☆☆☆ Found in Text Mining only
Harlequin Fetus	Harlequin Ichthyosis	BEFREE	15961576		★☆☆☆☆ Found in Text Mining only
Hashimoto Disease	Hashimoto Disease	BEFREE	28827034		★☆☆☆☆ Found in Text Mining only
Hematologic Diseases	Hematologic disease	Pubtator	10583274, 12139742	Associate	★☆☆☆☆ Found in Text Mining only
Hematologic Neoplasms	Hematologic Neoplasms	BEFREE	23768928, 24987056, 24990614, 26864107, 28242787, 29084989, 29118010, 29228209, 29625929, 30185037, 30918018, 31186046, 9365832		★☆☆☆☆ Found in Text Mining only
Hematologic Neoplasms	Hematologic neoplasm	Pubtator	32013131	Associate	★☆☆☆☆ Found in Text Mining only
Hematological Disease	Hematological Disease	BEFREE	29450576		★☆☆☆☆ Found in Text Mining only
Hematopoietic Neoplasms	Hematopoietic Neoplasms	BEFREE	23487024		★☆☆☆☆ Found in Text Mining only
Hemoglobinuria Paroxysmal	Hemoglobinuria paroxysmal	Pubtator	9616145	Associate	★☆☆☆☆ Found in Text Mining only
Hemophilia B	Hemophilia	BEFREE	11380446		★☆☆☆☆ Found in Text Mining only
Hemorrhage	Hemorrhage	Pubtator	12507894	Associate	★☆☆☆☆ Found in Text Mining only
Hepatitis B	Hepatitis b	Pubtator	29739341	Stimulate	★☆☆☆☆ Found in Text Mining only
Hepatitis C Chronic	Hepatitis c	Pubtator	21178437	Stimulate	★☆☆☆☆ Found in Text Mining only
Hepatitis C Chronic	Hepatitis c	Pubtator	33230233	Associate	★☆☆☆☆ Found in Text Mining only
Hepatomegaly	Hepatomegaly	Pubtator	11418478	Associate	★☆☆☆☆ Found in Text Mining only
Hereditary pancreatitis	Pancreatitis	Pubtator	32050977	Stimulate	★☆☆☆☆ Found in Text Mining only
Hodgkin Disease	Hodgkin disease	Pubtator	24065493	Associate	★☆☆☆☆ Found in Text Mining only
Hodgkin Disease	Hodgkin Disease	BEFREE	30009533		★☆☆☆☆ Found in Text Mining only
Hydrocephalus Normal Pressure	Normal pressure hydrocephalus	Pubtator	40055671	Associate	★☆☆☆☆ Found in Text Mining only
Hyperlipidemia	Hyperlipidemia	BEFREE	29750886		★☆☆☆☆ Found in Text Mining only
Hyperparathyroidism, Primary	Hyperparathyroidism	BEFREE	18230835		★☆☆☆☆ Found in Text Mining only
Hyperplasia	Hyperplasia	Pubtator	19382196	Associate	★☆☆☆☆ Found in Text Mining only
Hypertension	Hypertension	Pubtator	33362779	Associate	★☆☆☆☆ Found in Text Mining only
Hypertensive disease	Hypertension	BEFREE	28296029, 31504461		★☆☆☆☆ Found in Text Mining only
Hypotension	Hypotension	Pubtator	36524116	Associate	★☆☆☆☆ Found in Text Mining only
Immune System Diseases	Immune system disease	Pubtator	32083545	Associate	★☆☆☆☆ Found in Text Mining only
Immune thrombocytopenic purpura	Immune Thrombocytopenic Purpura	BEFREE	29924452		★☆☆☆☆ Found in Text Mining only
Immunologic Deficiency Syndromes	Immunologic Deficiency Syndromes	BEFREE	12560238, 18851688, 21132730, 21692849, 22214236, 22262762, 26774386, 31776569, 8977248		★☆☆☆☆ Found in Text Mining only
Inclusion Body Myositis (disorder)	Inclusion Body Myositis	BEFREE	30825520		★☆☆☆☆ Found in Text Mining only
Incontinentia Pigmenti Achromians	Incontinentia Pigmenti Achromians	BEFREE	10767487		★☆☆☆☆ Found in Text Mining only
Inflammatory Bowel Diseases	Inflammatory bowel disease	Pubtator	30127383, 34948292	Associate	★☆☆☆☆ Found in Text Mining only
Inflammatory Bowel Diseases	Inflammatory Bowel Disease	BEFREE	31179321		★☆☆☆☆ Found in Text Mining only
Intellectual Disability	Mental retardation	BEFREE	10533035, 15915161, 29556724		★☆☆☆☆ Found in Text Mining only
Intervertebral Disc Degeneration	Intervertebral Disc Degeneration	BEFREE	29718882, 29763470		★☆☆☆☆ Found in Text Mining only
Intestinal Neoplasms	Intestinal neoplasm	Pubtator	32490905	Associate	★☆☆☆☆ Found in Text Mining only
Iron Overload	Iron Overload	BEFREE	11328568		★☆☆☆☆ Found in Text Mining only
Juvenile Myelomonocytic Leukemia	Myelomonocytic Leukemia	BEFREE	25102944, 26983639		★☆☆☆☆ Found in Text Mining only
Keratitis	Keratitis	BEFREE	20943863		★☆☆☆☆ Found in Text Mining only
Kidney Failure, Acute	Kidney Failure	BEFREE	29080804		★☆☆☆☆ Found in Text Mining only
Kidney Neoplasm	Kidney Neoplasm	BEFREE	11438465		★☆☆☆☆ Found in Text Mining only
Latent Autoimmune Diabetes in Adults	Autoimmune Diabetes	BEFREE	15505998		★☆☆☆☆ Found in Text Mining only
Leiomyosarcoma of uterus	Leiomyosarcoma Of Uterus	BEFREE	3163264		★☆☆☆☆ Found in Text Mining only
Leishmaniasis	Leishmaniasis	Pubtator	21171992	Stimulate	★☆☆☆☆ Found in Text Mining only
Leukemia	Leukemia	Pubtator	10627459, 11418478, 12031655, 12673718, 15461863, 17684154, 18319522, 18326821, 18577710, 19951974, 20714440, 24377566, 26819054, 27465508, 28133783, 28718379, 30361682, 30733502, 32037392, 34446939, 34861144, 35271751, 35688455, 36278404, 37245251, 37933409, 7869031, 8286836, 8683901	Associate	★☆☆☆☆ Found in Text Mining only
leukemia	Leukemia	BEFREE	10969785, 11417476, 11477655, 1391936, 14692527, 1518308, 18626062, 1913594, 19147788, 20007546, 20028384, 21330473, 21393419, 21911423, 22262762, 23564444, 23686525, 23818607, 27465508, 27637890, 29234114, 2942200, 30733502, 30791598, 31307525, 31783629, 7579382, 7970717, 8036021, 9209472, 9315101, 9737689		★☆☆☆☆ Found in Text Mining only
leukemia	Leukemia	LHGDN	16329108, 16642047		★☆☆☆☆ Found in Text Mining only
Leukemia Hairy Cell	Hairy cell leukemia	Pubtator	23347903	Associate	★☆☆☆☆ Found in Text Mining only
Leukemia Myeloid	Myeloid leukemia	Pubtator	21156171	Associate	★☆☆☆☆ Found in Text Mining only
Leukemia Myeloid Acute	Myeloid leukemia	Pubtator	10627459, 11588023, 12717686, 16647568, 20662087, 22258035, 24377566, 25955299, 26450753, 28133783, 29720577, 29868798, 30414989, 30928626, 32037392, 32865882, 33375774, 34034795, 34432318, 36524116, 37288810, 9389707, 9662278	Associate	★☆☆☆☆ Found in Text Mining only
Leukemia Myelomonocytic Chronic	Myelomonocytic leukemia	Pubtator	23632888	Associate	★☆☆☆☆ Found in Text Mining only
Leukemia Myelomonocytic Juvenile	Myelomonocytic leukemia	Pubtator	23632888	Associate	★☆☆☆☆ Found in Text Mining only
Leukemia Promyelocytic Acute	Promyelocytic leukemia	Pubtator	12951526, 9624127	Associate	★☆☆☆☆ Found in Text Mining only
Leukemia, Myelocytic, Acute	Leukemia	BEFREE	10554802, 10637483, 10654451, 11264190, 11477655, 11588023, 11809673, 12096348, 16107895, 16643437, 16740770, 17039238, 18249061, 20227111, 20444543, 20804920, 20833819, 21330473, 21681188, 21734239, 22258035, 22262762, 22289983, 22532518, 23055153, 23564444, 23564911, 23818607, 23867470, 24103301, 25081372, 25725124, 25881148, 25955299, 26010294, 26059451, 26082270, 26858358, 27063991, 27065320, 27465508, 27611922, 28242787, 29065396, 29118010, 29206680, 29868798, 30126842, 30550585, 30624859, 30740913, 31002948, 31097000, 7579382, 7662954, 8839887, 9616163, 9694699		★☆☆☆☆ Found in Text Mining only
Leukemia, T-Cell	T-cell leukemia	BEFREE	1676542, 18162778, 24001773, 8634440		★☆☆☆☆ Found in Text Mining only
Lipoatrophy	Lipoatrophy	BEFREE	24129368		★☆☆☆☆ Found in Text Mining only
Lipodystrophy	Lipodystrophy	BEFREE	24129368		★☆☆☆☆ Found in Text Mining only
liposarcoma	Liposarcoma	BEFREE	9103213		★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	31552039, 31632568		★☆☆☆☆ Found in Text Mining only
Liver Cirrhosis	Liver cirrhosis	Pubtator	33230233	Associate	★☆☆☆☆ Found in Text Mining only
Liver Cirrhosis Biliary	Liver cirrhosis	Pubtator	22031474, 25627620	Associate	★☆☆☆☆ Found in Text Mining only
Lumbar scoliosis	Lumbar scoliosis	BEFREE	29490003		★☆☆☆☆ Found in Text Mining only
Lung Diseases	Lung disease	Pubtator	33123122	Stimulate	★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung neoplasms	Pubtator	22592563, 33934206	Associate	★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus	Lupus Erythematosus	BEFREE	29463868, 30257456		★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus Systemic	Systemic lupus erythematosus	Pubtator	11067960, 26968426, 29720240, 31231380, 31914379, 33007439, 33670902, 33777025, 33828555, 36165173, 39333474, 9099929, 9528907	Associate	★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus Systemic	Systemic lupus erythematosus	Pubtator	15843451, 21320038, 26090500	Stimulate	★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus, Discoid	Lupus Erythematosus	BEFREE	29463868, 30257456		★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus, Systemic	Lupus Erythematosus	BEFREE	11067960, 15219386, 21320038, 29463868, 29720240, 30257456, 30771230		★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus, Systemic	Lupus Erythematosus	LHGDN	15964076		★☆☆☆☆ Found in Text Mining only
Lupus Nephritis	Lupus nephritis	Pubtator	25306868	Associate	★☆☆☆☆ Found in Text Mining only
Lupus Nephritis	Lupus Nephritis	BEFREE	29458096		★☆☆☆☆ Found in Text Mining only
Lupus Vulgaris	Lupus Vulgaris	BEFREE	29463868, 30257456		★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic metastasis	Pubtator	32050977	Associate	★☆☆☆☆ Found in Text Mining only
Lymphocytosis	Lymphocytosis	BEFREE	17534928		★☆☆☆☆ Found in Text Mining only
Lymphoid leukemia	Lymphoid leukemia	LHGDN	12368155, 16825496, 16932341		★☆☆☆☆ Found in Text Mining only
Lymphoid leukemia	Lymphoid leukemia	BEFREE	8207990		★☆☆☆☆ Found in Text Mining only
Lymphoma	Lymphoma	BEFREE	10830748, 29450576, 30734478, 30791598, 31118070, 31484540, 7890279		★☆☆☆☆ Found in Text Mining only
Lymphoma	Lymphoma	LHGDN	14596927, 16839787		★☆☆☆☆ Found in Text Mining only
Lymphoma	Lymphoma	Pubtator	15461863, 22041376, 34021248, 34361811, 36153593	Associate	★☆☆☆☆ Found in Text Mining only
Lymphoma Follicular	Lymphoma	Pubtator	18500740	Associate	★☆☆☆☆ Found in Text Mining only
Lymphoma Follicular	Lymphoma	Pubtator	19382196	Inhibit	★☆☆☆☆ Found in Text Mining only
Lymphoma, Follicular	Lymphoma	BEFREE	16645239		★☆☆☆☆ Found in Text Mining only
Lymphoma, Non-Hodgkin	Non-Hodgkin lymphoma	BEFREE	25564959, 29158362, 31296574		★☆☆☆☆ Found in Text Mining only
Lymphoma, Non-Hodgkin, Familial	Lymphoma	BEFREE	31296574		★☆☆☆☆ Found in Text Mining only
Lymphoproliferative Disorders	Lymphoproliferative Disorder	LHGDN	16642047		★☆☆☆☆ Found in Text Mining only
Malignant Bone Neoplasm	Malignant Bone Neoplasm	BEFREE	29096654		★☆☆☆☆ Found in Text Mining only
Malignant Childhood Neoplasm	Malignant Neoplasm	BEFREE	12469236		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	16475675, 21028875, 26552643		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of esophagus	Esophagus Neoplasm	BEFREE	26294209, 29563330		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of lung	Lung Cancer	BEFREE	22592563, 28573863, 29228209, 30430389		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	BEFREE	27926864, 29464091, 30076241		★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	10554802, 11107170, 16321850, 16475675, 1825682, 21432817, 22592563, 23576305, 24987056, 2539641, 25453902, 26294209, 26858358, 28242787, 28249894, 28573863, 28851813, 29025767, 29065396, 29158362, 29228209, 29482842, 29563330, 29702148, 29982719, 30181171, 30826127, 30918018, 31427259, 31552039		★☆☆☆☆ Found in Text Mining only
Malignant Peripheral Nerve Sheath Tumor	Malignant Peripheral Nerve Sheath Tumor	BEFREE	11106084, 11144931, 11910511, 12065770		★☆☆☆☆ Found in Text Mining only
Malignant tumor of cervix	Cervical Tumor	BEFREE	25310288		★☆☆☆☆ Found in Text Mining only
Mantle cell lymphoma	Mantle Cell Lymphoma	BEFREE	20956803, 24352646, 26699502, 29246179, 30795996		★☆☆☆☆ Found in Text Mining only
Mastocytosis, Systemic	Mastocytosis	BEFREE	7828159		★☆☆☆☆ Found in Text Mining only
Melanoma	Melanoma	Pubtator	26329660, 30872676, 37505479	Associate	★☆☆☆☆ Found in Text Mining only
melanoma	Melanoma	BEFREE	28283001, 30159123		★☆☆☆☆ Found in Text Mining only
Menkes Kinky Hair Syndrome	Menkes Kinky Hair Syndrome	BEFREE	19092723, 9788559		★☆☆☆☆ Found in Text Mining only
Mental Depression	Mental Depression	BEFREE	28300618, 29860184		★☆☆☆☆ Found in Text Mining only
Mental Retardation	Mental retardation	BEFREE	10533035, 15915161		★☆☆☆☆ Found in Text Mining only
Metabolic Diseases	Metabolic Diseases	BEFREE	23172919		★☆☆☆☆ Found in Text Mining only
Metabolic Diseases	Metabolic syndrome	Pubtator	34847942	Associate	★☆☆☆☆ Found in Text Mining only
Metabolic Syndrome X	Metabolic Syndrome	BEFREE	23172919		★☆☆☆☆ Found in Text Mining only
Micrognathism	Micrognathism	BEFREE	9788559		★☆☆☆☆ Found in Text Mining only
Microphthalmos	Microphthalmos	BEFREE	2308157, 27556823		★☆☆☆☆ Found in Text Mining only
Mild Mental Retardation	Mental retardation	BEFREE	17343270, 18412109		★☆☆☆☆ Found in Text Mining only
Miller Dieker syndrome	Miller Dieker Syndrome	BEFREE	8585563		★☆☆☆☆ Found in Text Mining only
Monoclonal B-Cell Lymphocytosis	B-Cell Lymphocytosis	BEFREE	20839337		★☆☆☆☆ Found in Text Mining only
Monoclonal Gammopathy of Undetermined Significance	Monoclonal Gammapathies	BEFREE	15334545, 8704185		★☆☆☆☆ Found in Text Mining only
Mouth Neoplasms	Mouth neoplasm	Pubtator	36597662	Associate	★☆☆☆☆ Found in Text Mining only
Mucopolysaccharidosis II	Mucopolysaccharidosis	BEFREE	2128908		★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Multiple myeloma	Pubtator	10027726, 10233376, 10560909, 10606891, 10848782, 10911386, 11823041, 12001122, 15578069, 23019187, 23021410, 23168070, 23438504, 23755763, 23818359, 24489445, 27251573, 27307294, 27418644, 28249894, 29025767, 29089645, 29577600, 29806594, 29847570, 30228232, 31991058, 32013131, 32041300, 32296125, 32350373, 32457357, 32844992, 32922390, 33375774, 34034795, 34288263, 34471932, 34625791, 34643211, 34861144, 35294519, 35563109, 35985681, 36359760, 36446823, 37648670, 37945755, 37995467, 38035078, 38102941, 38139060, 40665393, 7524764, 8329711, 8797890, 9292530	Associate	★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Multiple myeloma	BEFREE	10627470, 11953033, 12094261, 12804633, 14500379, 14531906, 15068900, 18626062, 20969860, 23438504, 23450831, 23770975, 24987056, 25591497, 25907102, 26071561, 26100534, 26156801, 26443328, 26858358, 26864107, 27611189, 27859027, 27896689, 28042457, 28249894, 28259300, 28341874, 28373875, 28470777, 28474745, 28506593, 28573863, 28615223, 28840598, 28915615, 29025767, 29025987, 29054515, 29084989, 29118010, 29158362, 29196043, 29228209, 29301755, 29369430, 29372735, 29415351, 29450576, 29465271, 29500635, 29577600, 29582696, 29741423, 29847570, 29907292, 29915586, 29982719, 29988376, 30033840, 30035857, 30079070, 30147690, 30185037, 30288349, 30294326, 30329116, 30394809, 30403942, 30459772, 30524421, 30546360, 30620407, 30622116, 30692097, 30791634, 30795996, 30846477, 30858549, 30940652, 30951198, 31043428, 31068926, 31115879, 31118070, 31125526, 31270103, 31395601, 31413916, 31427259, 31449666, 31679012, 31693245, 31779273, 31783629, 31842517, 31847204, 7535594, 8391243, 8704185		★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Multiple myeloma	Pubtator	36867577	Stimulate	★☆☆☆☆ Found in Text Mining only
Multiple Sclerosis	Multiple Sclerosis	BEFREE	27519689, 29024167		★☆☆☆☆ Found in Text Mining only
Multiple Sclerosis	Multiple sclerosis	Pubtator	35868128, 38548324	Associate	★☆☆☆☆ Found in Text Mining only
Muscular Dystrophy	Muscular dystrophy	BEFREE	28625013		★☆☆☆☆ Found in Text Mining only
Muscular Dystrophy, Duchenne	Duchenne Muscular Dystrophy	BEFREE	3614347, 3742857, 3777020		★☆☆☆☆ Found in Text Mining only
MYELODYSPLASTIC SYNDROME	Myelodysplastic Syndrome	BEFREE	10979941, 11979559, 12070035, 12620294, 17616640, 18310541, 22753872, 23219618, 24799522, 26643973		★☆☆☆☆ Found in Text Mining only
Myelodysplastic Syndromes	Myelodysplastic syndrome	Pubtator	12070035, 20662087, 22753872, 30928626, 33369070, 38575672, 7528567	Associate	★☆☆☆☆ Found in Text Mining only
Myelodysplastic Syndromes	Myelodysplastic syndrome	Pubtator	19644143	Inhibit	★☆☆☆☆ Found in Text Mining only
Myeloid Leukemia	Myeloid Leukemia	BEFREE	12676784		★☆☆☆☆ Found in Text Mining only
Myeloid Leukemia, Chronic	Myeloid Leukemia	BEFREE	17470736, 20805474, 21132730, 21911423, 21931114, 24574458, 24778155, 24967705, 26607600, 26985855, 28233439, 28533480, 30017934, 30091999, 30126842, 6933152, 7541674, 9305602, 9746786, 9789216		★☆☆☆☆ Found in Text Mining only
Myocardial Ischemia	Myocardial Ischemia	CTD_human_DG	16214533		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Myoclonic dystonia	Myoclonic dystonia	Pubtator	34288263	Inhibit	★☆☆☆☆ Found in Text Mining only
Myopathy	Myopathy	BEFREE	7908614		★☆☆☆☆ Found in Text Mining only
Nasopharyngeal carcinoma	Nasopharyngeal Carcinoma	BEFREE	25630761, 30535454		★☆☆☆☆ Found in Text Mining only
Nasopharyngeal Carcinoma	Nasopharyngeal carcinoma	Pubtator	30535454	Associate	★☆☆☆☆ Found in Text Mining only
Native American myopathy	Native american myopathy	Pubtator	23880765	Associate	★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	10640804, 10688041, 10935649, 11106084, 11144931, 11207827, 11839563, 11854597, 12409719, 1379714, 15747098, 15800948, 16284948, 1648955, 16740029, 16825496, 1683261, 17175375, 17339184, 17464314, 17509396, 17516747, 17620295, 18162778, 18326821, 19215793, 20340132, 20511669, 20952280, 21737666, 22223660, 22503486, 26294209, 26669617, 26864107, 27334220, 27611189, 27896689, 28346326, 29084989, 29129787, 29228209, 29246179, 29301755, 29450576, 29500635, 29702148, 30009533, 30012853, 30076241, 30513816, 30535454, 30689488, 30826127, 31504844, 31632568, 7534671, 9242211, 9530345		★☆☆☆☆ Found in Text Mining only
Nephroblastoma	Nephroblastoma	BEFREE	17620295		★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	BEFREE	1679663, 18336735, 19214114		★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	Pubtator	18336735	Associate	★☆☆☆☆ Found in Text Mining only
Neurocognitive Disorders	Neurocognitive Disorders	BEFREE	18581239		★☆☆☆☆ Found in Text Mining only
Neurodegenerative Disorders	Neurodegenerative Disorders	BEFREE	26957304		★☆☆☆☆ Found in Text Mining only
Neurodevelopmental Disorders	Neurodevelopmental Disorders	BEFREE	17287729		★☆☆☆☆ Found in Text Mining only
Neuroectodermal Tumor, Primitive	Neuroectodermal Tumors	BEFREE	9103213		★☆☆☆☆ Found in Text Mining only
neurofibroma	Neurofibroma	BEFREE	11910511		★☆☆☆☆ Found in Text Mining only
Neurofibromatoses	Neurofibromatosis	BEFREE	11910511		★☆☆☆☆ Found in Text Mining only
Neurofibromatosis 1	Neurofibromatosis	BEFREE	11910511, 12065770, 8561028		★☆☆☆☆ Found in Text Mining only
Neurogenic Urinary Bladder	Neurogenic Urinary Bladder	BEFREE	24510694		★☆☆☆☆ Found in Text Mining only
NEUROTICISM	Neuroticism	BEFREE	24458227		★☆☆☆☆ Found in Text Mining only
Neutropenia	Neutropenia	Pubtator	10583274	Associate	★☆☆☆☆ Found in Text Mining only
Non-Small Cell Lung Carcinoma	Lung carcinoma	BEFREE	28573863, 31455042		★☆☆☆☆ Found in Text Mining only
Nonalcoholic Steatohepatitis	Non-alcoholic Fatty Liver Disease	BEFREE	31465774		★☆☆☆☆ Found in Text Mining only
Norrie disease	Norrie Disease	BEFREE	9895245		★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	BEFREE	23172919, 28816006, 29482842, 30114710		★☆☆☆☆ Found in Text Mining only
Optic Nerve Glioma	Optic Nerve Glioma	BEFREE	8561028		★☆☆☆☆ Found in Text Mining only
Osteogenesis Imperfecta	Osteogenesis Imperfecta	BEFREE	31398526		★☆☆☆☆ Found in Text Mining only
Osteopenia	Osteopenia	BEFREE	16369895, 24888801, 27480628, 31072650		★☆☆☆☆ Found in Text Mining only
Osteoporosis	Osteoporosis	BEFREE	27480628, 31072650		★☆☆☆☆ Found in Text Mining only
Osteoporosis, Postmenopausal	Osteoporosis	BEFREE	16369895		★☆☆☆☆ Found in Text Mining only
Ovarian Failure, Premature	Ovarian Failure	BEFREE	18230835, 21150920		★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Ovarian neoplasm	Pubtator	37415732	Associate	★☆☆☆☆ Found in Text Mining only
Pancreatitis	Pancreatitis	BEFREE	23940051		★☆☆☆☆ Found in Text Mining only
Pancreatitis	Pancreatitis	Pubtator	39620226	Associate	★☆☆☆☆ Found in Text Mining only
Papillary Renal Cell Carcinoma	Papillary Renal Carcinoma	BEFREE	8406438, 8431910, 9494621		★☆☆☆☆ Found in Text Mining only
Papillary thyroid carcinoma	Papillary thyroid carcinoma	BEFREE	7519046		★☆☆☆☆ Found in Text Mining only
Papilledema	Papilledema	BEFREE	27816875		★☆☆☆☆ Found in Text Mining only
Paraplegia	Paraplegia	BEFREE	29893620		★☆☆☆☆ Found in Text Mining only
Paraproteinemias	Paraproteinemia	BEFREE	21208658		★☆☆☆☆ Found in Text Mining only
Parkinson Disease	Parkinson disease	BEFREE	26957304, 29649522, 30871733		★☆☆☆☆ Found in Text Mining only
Parkinson Disease	Parkinson disease	Pubtator	33523105, 35279225, 36759259, 37673381	Associate	★☆☆☆☆ Found in Text Mining only
Parkinson Disease	Parkinson disease	Pubtator	40635349	Stimulate	★☆☆☆☆ Found in Text Mining only
Paroxysmal nocturnal hemoglobinuria	Paroxysmal nocturnal hemoglobinuria	BEFREE	12543108		★☆☆☆☆ Found in Text Mining only
Partial Trisomy	Trisomy	BEFREE	7307309, 881200		★☆☆☆☆ Found in Text Mining only
Periodontitis	Periodontitis	BEFREE	30346027		★☆☆☆☆ Found in Text Mining only
Pervasive Development Disorder	Autism spectrum disorder	BEFREE	20435366, 21528155, 28736241, 30896946		★☆☆☆☆ Found in Text Mining only
Polycystic Ovary Syndrome	Polycystic ovary syndrome	Pubtator	34847942, 38189053	Associate	★☆☆☆☆ Found in Text Mining only
Polycythemia Vera	Polycythemia vera	Pubtator	16603627	Associate	★☆☆☆☆ Found in Text Mining only
Precursor B-cell lymphoblastic leukemia	Lymphoblastic Leukemia	BEFREE	2732004, 30532071		★☆☆☆☆ Found in Text Mining only
Precursor Cell Lymphoblastic Leukemia Lymphoma	Lymphoblastic Leukemia	BEFREE	10637483, 29118010, 30126842, 7529552, 8207990		★☆☆☆☆ Found in Text Mining only
Precursor T-Cell Lymphoblastic Leukemia-Lymphoma	Lymphoblastic Leukemia	BEFREE	1717256, 1741251, 1777411, 19055661, 2078512, 2326274, 2885838, 29305553, 2946333, 30466749, 7902555, 7905617, 8559142, 9365832, 9695407, 9737689		★☆☆☆☆ Found in Text Mining only
Premature Menopause	Premature Menopause	BEFREE	19663602, 21150920		★☆☆☆☆ Found in Text Mining only
Presenile dementia	Senile Dementia	BEFREE	18581239		★☆☆☆☆ Found in Text Mining only
Primary amyloidosis	Amyloidosis	BEFREE	29226427, 29577600, 30033840, 31486522		★☆☆☆☆ Found in Text Mining only
Primary physiologic amenorrhea	Physiologic Amenorrhea	BEFREE	1083194		★☆☆☆☆ Found in Text Mining only
Profound Mental Retardation	Mental retardation	BEFREE	9788559		★☆☆☆☆ Found in Text Mining only
Prostate carcinoma	Prostate cancer	BEFREE	27926864, 29464091, 30076241		★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	26289091, 27926864, 33678520, 36124532	Associate	★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	30076241, 34019593	Inhibit	★☆☆☆☆ Found in Text Mining only
Pseudohyperkalemia Cardiff	Pseudohyperkalemia Cardiff	BEFREE	28810658		★☆☆☆☆ Found in Text Mining only
Psoriasis	Psoriasis	BEFREE	28461105		★☆☆☆☆ Found in Text Mining only
Pulmonary Disease Chronic Obstructive	Chronic obstructive pulmonary disease	Pubtator	24634087	Associate	★☆☆☆☆ Found in Text Mining only
Reifenstein Syndrome	Reifenstein Syndrome	BEFREE	15452386		★☆☆☆☆ Found in Text Mining only
Renal Cell Carcinoma	Renal Carcinoma	BEFREE	10198623, 10484980, 11313885, 11717438, 12407697, 12469236, 15383938, 16807766, 2568884, 26415891, 27556823		★☆☆☆☆ Found in Text Mining only
Rheumatoid Arthritis	Rheumatoid arthritis	BEFREE	12562401, 24397353, 29603313, 29720240, 31661005		★☆☆☆☆ Found in Text Mining only
Schizophrenia	Schizophrenia	BEFREE	29108272		★☆☆☆☆ Found in Text Mining only
Scoliosis, unspecified	Scoliosis	BEFREE	31398526		★☆☆☆☆ Found in Text Mining only
Secondary physiologic amenorrhea	Secondary Physiologic Amenorrhea	BEFREE	7759283		★☆☆☆☆ Found in Text Mining only
Seizures	Seizures	Pubtator	34244562	Associate	★☆☆☆☆ Found in Text Mining only
Septicemia	Septicemia	BEFREE	29030054, 30915370		★☆☆☆☆ Found in Text Mining only
Severe Combined Immunodeficiency	Severe combined immunodeficiency disease	BEFREE	27301863		★☆☆☆☆ Found in Text Mining only
Sezary Syndrome	Sezary syndrome	Pubtator	35251370	Associate	★☆☆☆☆ Found in Text Mining only
Sick Sinus Syndrome	Sick sinus syndrome	Pubtator	18024373	Associate	★☆☆☆☆ Found in Text Mining only
Sjogren's Syndrome	Sjogren syndrome	Pubtator	35359935	Associate	★☆☆☆☆ Found in Text Mining only
Sleep Apnea, Central	Sleep Apnea	BEFREE	27981803		★☆☆☆☆ Found in Text Mining only
Solitary fibrous tumor	Solitary fibrous tumor	BEFREE	20191330		★☆☆☆☆ Found in Text Mining only
Spina Bifida	Spina Bifida	BEFREE	30577407		★☆☆☆☆ Found in Text Mining only
Spinal Cord Diseases	Spinal Cord Diseases	BEFREE	26552643		★☆☆☆☆ Found in Text Mining only
Splenomegaly	Splenomegaly	Pubtator	11675331	Stimulate	★☆☆☆☆ Found in Text Mining only
Spondyloepiphyseal Dysplasia	Spondyloepiphyseal dysplasia	BEFREE	1456283		★☆☆☆☆ Found in Text Mining only
Spondyloepiphyseal dysplasia, congenita	Spondyloepiphyseal dysplasia congenita	BEFREE	1456283		★☆☆☆☆ Found in Text Mining only
Squamous Cell Carcinoma of Head and Neck	Squamous cell carcinoma	Pubtator	33529452	Associate	★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	26378021	Associate	★☆☆☆☆ Found in Text Mining only
Subarachnoid Hemorrhage	Subarachnoid hemorrhage	BEFREE	28283001		★☆☆☆☆ Found in Text Mining only
synovial sarcoma	Synovial sarcoma	BEFREE	10718206, 10935649, 11106084, 11144931, 11150604, 11172303, 11207827, 11308259, 11423977, 11826189, 11845884, 11854597, 11910511, 11957149, 12004001, 12034530, 12173050, 12409719, 12552937, 12687023, 14669292, 15325093, 1648957, 16557276, 17101797, 17175375, 17509396, 18325475, 19214114, 19215793, 19267417, 20189377, 22537253, 23313505, 23319690, 24436244, 2541892, 25614489, 26415226, 2842027, 28851813, 29490565, 7497448, 7519051, 8579122, 8697803, 8760306, 8840996, 9378559, 9556426, 9582520, 9865642		★☆☆☆☆ Found in Text Mining only
Synovitis	Synovitis	Pubtator	22251373	Associate	★☆☆☆☆ Found in Text Mining only
Syringomyelia	Syringomyelia	BEFREE	30486806		★☆☆☆☆ Found in Text Mining only
T-Cell Prolymphocytic Leukemia	T-Cell Prolymphocytic Leukemia	BEFREE	1283320		★☆☆☆☆ Found in Text Mining only
THANATOPHORIC DYSPLASIA, TYPE I (disorder)	Thanatophoric Dysplasia	BEFREE	20643858		★☆☆☆☆ Found in Text Mining only
Thyroid Cancer Papillary	Papillary thyroid cancer	Pubtator	32050977	Associate	★☆☆☆☆ Found in Text Mining only
Triple Negative Breast Neoplasms	Triple negative breast cancer	Pubtator	29899747, 37894900	Associate	★☆☆☆☆ Found in Text Mining only
Turner Syndrome	Turner Syndrome	BEFREE	1083194, 3742848, 8585557		★☆☆☆☆ Found in Text Mining only
Ulcerative Colitis	Ulcerative colitis	BEFREE	31179321		★☆☆☆☆ Found in Text Mining only
Urinary Bladder Neoplasms	Urinary bladder neoplasms	Pubtator	31823416	Associate	★☆☆☆☆ Found in Text Mining only
Urticaria	Urticaria	BEFREE	29510721		★☆☆☆☆ Found in Text Mining only
Uterine Cervical Neoplasms	Uterine neoplasm	Pubtator	40460909	Associate	★☆☆☆☆ Found in Text Mining only
Uterine Fibroids	Uterine Fibroids	BEFREE	15313893		★☆☆☆☆ Found in Text Mining only
Vasculitis	Vasculitis	Pubtator	25376552	Associate	★☆☆☆☆ Found in Text Mining only
Vasospasm Intracranial	Intracranial vasospasm	Pubtator	34244562	Stimulate	★☆☆☆☆ Found in Text Mining only
Von Hippel-Lindau Syndrome	Von Hippel-Lindau Syndrome	BEFREE	2568884		★☆☆☆☆ Found in Text Mining only
Waldenstrom Macroglobulinemia	Waldenstrom`s Macroglobulinemia	BEFREE	30080238		★☆☆☆☆ Found in Text Mining only
Waldenstrom Macroglobulinemia	Waldenstrom macroglobulinemia	Pubtator	32457988	Associate	★☆☆☆☆ Found in Text Mining only
Waldenstrom Macroglobulinemia	Waldenstrom macroglobulinemia	Pubtator	9840911	Stimulate	★☆☆☆☆ Found in Text Mining only
XX males	XX Males	BEFREE	7486824		★☆☆☆☆ Found in Text Mining only