Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	9510
Gene name	ADAM metallopeptidase with thrombospondin type 1 motif 1
Gene symbol	ADAMTS1
Synonyms (NCBI Gene)	C3-C5METH1
Chromosome	21
Chromosome location	21q21.3
Summary	This gene encodes a member of the ADAMTS (a disintegrin and metalloproteinase with thrombospondin motif) protein family. Members of the family share several distinct protein modules, including a propeptide region, a metalloproteinase domain, a disintegrin

349

Show/Hide all (349)

miRTarBase ID	miRNA	Experiments	Reference
MIRT022469	hsa-miR-124-3p	Microarray	18668037
MIRT029236	hsa-miR-26b-5p	Microarray	19088304
MIRT049047	hsa-miR-92a-3p	CLASH	23622248
MIRT040291	hsa-miR-615-3p	CLASH	23622248
MIRT036972	hsa-miR-877-3p	CLASH	23622248
MIRT036972	hsa-miR-877-3p	CLASH	23622248
MIRT724228	hsa-miR-5196-3p	HITS-CLIP	19536157
MIRT724227	hsa-miR-4793-5p	HITS-CLIP	19536157
MIRT724226	hsa-miR-5193	HITS-CLIP	19536157
MIRT724225	hsa-miR-660-3p	HITS-CLIP	19536157
MIRT724224	hsa-miR-581	HITS-CLIP	19536157
MIRT724223	hsa-miR-6854-3p	HITS-CLIP	19536157
MIRT724222	hsa-miR-1180-3p	HITS-CLIP	19536157
MIRT724228	hsa-miR-5196-3p	HITS-CLIP	19536157
MIRT724227	hsa-miR-4793-5p	HITS-CLIP	19536157
MIRT724226	hsa-miR-5193	HITS-CLIP	19536157
MIRT724225	hsa-miR-660-3p	HITS-CLIP	19536157
MIRT724224	hsa-miR-581	HITS-CLIP	19536157
MIRT724223	hsa-miR-6854-3p	HITS-CLIP	19536157
MIRT724222	hsa-miR-1180-3p	HITS-CLIP	19536157
MIRT766326	hsa-let-7a	CLIP-seq
MIRT766327	hsa-let-7b	CLIP-seq
MIRT766328	hsa-let-7c	CLIP-seq
MIRT766329	hsa-let-7d	CLIP-seq
MIRT766330	hsa-let-7e	CLIP-seq
MIRT766331	hsa-let-7f	CLIP-seq
MIRT766332	hsa-let-7g	CLIP-seq
MIRT766333	hsa-let-7i	CLIP-seq
MIRT766334	hsa-miR-1229	CLIP-seq
MIRT766335	hsa-miR-1294	CLIP-seq
MIRT766336	hsa-miR-202	CLIP-seq
MIRT766337	hsa-miR-3160-3p	CLIP-seq
MIRT766338	hsa-miR-3161	CLIP-seq
MIRT766339	hsa-miR-3174	CLIP-seq
MIRT766340	hsa-miR-342-3p	CLIP-seq
MIRT766341	hsa-miR-3606	CLIP-seq
MIRT766342	hsa-miR-4261	CLIP-seq
MIRT766343	hsa-miR-4458	CLIP-seq
MIRT766344	hsa-miR-4496	CLIP-seq
MIRT766345	hsa-miR-4500	CLIP-seq
MIRT766346	hsa-miR-4637	CLIP-seq
MIRT766347	hsa-miR-4729	CLIP-seq
MIRT766348	hsa-miR-4795-3p	CLIP-seq
MIRT766349	hsa-miR-548a-5p	CLIP-seq
MIRT766350	hsa-miR-548ab	CLIP-seq
MIRT766351	hsa-miR-548ak	CLIP-seq
MIRT766352	hsa-miR-548b-5p	CLIP-seq
MIRT766353	hsa-miR-548c-5p	CLIP-seq
MIRT766354	hsa-miR-548d-5p	CLIP-seq
MIRT766355	hsa-miR-548h	CLIP-seq
MIRT766356	hsa-miR-548i	CLIP-seq
MIRT766357	hsa-miR-548j	CLIP-seq
MIRT766358	hsa-miR-548k	CLIP-seq
MIRT766359	hsa-miR-548l	CLIP-seq
MIRT766360	hsa-miR-548w	CLIP-seq
MIRT766361	hsa-miR-548y	CLIP-seq
MIRT766362	hsa-miR-556-3p	CLIP-seq
MIRT766363	hsa-miR-559	CLIP-seq
MIRT766364	hsa-miR-921	CLIP-seq
MIRT766365	hsa-miR-98	CLIP-seq
MIRT2167122	hsa-miR-4666-5p	CLIP-seq
MIRT766349	hsa-miR-548a-5p	CLIP-seq
MIRT766350	hsa-miR-548ab	CLIP-seq
MIRT766351	hsa-miR-548ak	CLIP-seq
MIRT766352	hsa-miR-548b-5p	CLIP-seq
MIRT766353	hsa-miR-548c-5p	CLIP-seq
MIRT766354	hsa-miR-548d-5p	CLIP-seq
MIRT766355	hsa-miR-548h	CLIP-seq
MIRT766356	hsa-miR-548i	CLIP-seq
MIRT766357	hsa-miR-548j	CLIP-seq
MIRT766358	hsa-miR-548k	CLIP-seq
MIRT766359	hsa-miR-548l	CLIP-seq
MIRT766360	hsa-miR-548w	CLIP-seq
MIRT766361	hsa-miR-548y	CLIP-seq
MIRT766363	hsa-miR-559	CLIP-seq
MIRT2425950	hsa-miR-1273f	CLIP-seq
MIRT2425951	hsa-miR-143	CLIP-seq
MIRT2425952	hsa-miR-147	CLIP-seq
MIRT2425953	hsa-miR-194	CLIP-seq
MIRT2425954	hsa-miR-2054	CLIP-seq
MIRT2425955	hsa-miR-219-5p	CLIP-seq
MIRT2425956	hsa-miR-302f	CLIP-seq
MIRT2425957	hsa-miR-3074-3p	CLIP-seq
MIRT2425958	hsa-miR-3146	CLIP-seq
MIRT2425959	hsa-miR-34c-3p	CLIP-seq
MIRT2425960	hsa-miR-365	CLIP-seq
MIRT2425961	hsa-miR-3682-5p	CLIP-seq
MIRT2425962	hsa-miR-3941	CLIP-seq
MIRT2425963	hsa-miR-4263	CLIP-seq
MIRT2425964	hsa-miR-433	CLIP-seq
MIRT2425965	hsa-miR-4445	CLIP-seq
MIRT2425966	hsa-miR-4499	CLIP-seq
MIRT2425967	hsa-miR-4508	CLIP-seq
MIRT2425968	hsa-miR-4532	CLIP-seq
MIRT2425969	hsa-miR-466	CLIP-seq
MIRT2425970	hsa-miR-4672	CLIP-seq
MIRT2425971	hsa-miR-4708-5p	CLIP-seq
MIRT2425972	hsa-miR-4719	CLIP-seq
MIRT2425973	hsa-miR-4731-3p	CLIP-seq
MIRT2425974	hsa-miR-4770	CLIP-seq
MIRT2425975	hsa-miR-4782-3p	CLIP-seq
MIRT766348	hsa-miR-4795-3p	CLIP-seq
MIRT2425976	hsa-miR-4799-5p	CLIP-seq
MIRT2425977	hsa-miR-4801	CLIP-seq
MIRT2425978	hsa-miR-508-3p	CLIP-seq
MIRT2425979	hsa-miR-548u	CLIP-seq
MIRT2425980	hsa-miR-576-5p	CLIP-seq
MIRT2425981	hsa-miR-767-3p	CLIP-seq
MIRT2469737	hsa-miR-1226	CLIP-seq
MIRT2469738	hsa-miR-1248	CLIP-seq
MIRT2469739	hsa-miR-1270	CLIP-seq
MIRT2425950	hsa-miR-1273f	CLIP-seq
MIRT2469740	hsa-miR-1287	CLIP-seq
MIRT2469741	hsa-miR-129-3p	CLIP-seq
MIRT766335	hsa-miR-1294	CLIP-seq
MIRT2469742	hsa-miR-138	CLIP-seq
MIRT2425951	hsa-miR-143	CLIP-seq
MIRT2469743	hsa-miR-1470	CLIP-seq
MIRT2469744	hsa-miR-15a	CLIP-seq
MIRT2469745	hsa-miR-15b	CLIP-seq
MIRT2469746	hsa-miR-16	CLIP-seq
MIRT2469747	hsa-miR-181a	CLIP-seq
MIRT2469748	hsa-miR-181b	CLIP-seq
MIRT2469749	hsa-miR-181c	CLIP-seq
MIRT2469750	hsa-miR-181d	CLIP-seq
MIRT2469751	hsa-miR-193a-3p	CLIP-seq
MIRT2469752	hsa-miR-193b	CLIP-seq
MIRT2425953	hsa-miR-194	CLIP-seq
MIRT2469753	hsa-miR-195	CLIP-seq
MIRT2469754	hsa-miR-197	CLIP-seq
MIRT2425954	hsa-miR-2054	CLIP-seq
MIRT2469755	hsa-miR-214	CLIP-seq
MIRT2425956	hsa-miR-302f	CLIP-seq
MIRT2469756	hsa-miR-31	CLIP-seq
MIRT2469757	hsa-miR-3125	CLIP-seq
MIRT2469758	hsa-miR-3128	CLIP-seq
MIRT2469759	hsa-miR-3130-3p	CLIP-seq
MIRT2469760	hsa-miR-3135b	CLIP-seq
MIRT2469761	hsa-miR-3152-5p	CLIP-seq
MIRT2469762	hsa-miR-3157-3p	CLIP-seq
MIRT2469763	hsa-miR-3160-5p	CLIP-seq
MIRT766338	hsa-miR-3161	CLIP-seq
MIRT766339	hsa-miR-3174	CLIP-seq
MIRT2469764	hsa-miR-330-3p	CLIP-seq
MIRT766341	hsa-miR-3606	CLIP-seq
MIRT2469765	hsa-miR-3613-3p	CLIP-seq
MIRT2469766	hsa-miR-3614-3p	CLIP-seq
MIRT2469767	hsa-miR-3619-3p	CLIP-seq
MIRT2469768	hsa-miR-3619-5p	CLIP-seq
MIRT2469769	hsa-miR-3667-3p	CLIP-seq
MIRT2469770	hsa-miR-3916	CLIP-seq
MIRT2425962	hsa-miR-3941	CLIP-seq
MIRT2469771	hsa-miR-409-5p	CLIP-seq
MIRT2469772	hsa-miR-424	CLIP-seq
MIRT2469773	hsa-miR-4262	CLIP-seq
MIRT2425963	hsa-miR-4263	CLIP-seq
MIRT2469774	hsa-miR-4290	CLIP-seq
MIRT2469775	hsa-miR-4291	CLIP-seq
MIRT2469776	hsa-miR-4312	CLIP-seq
MIRT2469777	hsa-miR-4446-5p	CLIP-seq
MIRT2425966	hsa-miR-4499	CLIP-seq
MIRT2469778	hsa-miR-4524	CLIP-seq
MIRT2469779	hsa-miR-4535	CLIP-seq
MIRT2425969	hsa-miR-466	CLIP-seq
MIRT2469780	hsa-miR-4663	CLIP-seq
MIRT2469781	hsa-miR-4667-3p	CLIP-seq
MIRT2469782	hsa-miR-4670-3p	CLIP-seq
MIRT2425970	hsa-miR-4672	CLIP-seq
MIRT2469783	hsa-miR-4683	CLIP-seq
MIRT2425971	hsa-miR-4708-5p	CLIP-seq
MIRT2469784	hsa-miR-4713-5p	CLIP-seq
MIRT2425972	hsa-miR-4719	CLIP-seq
MIRT2425973	hsa-miR-4731-3p	CLIP-seq
MIRT2469785	hsa-miR-4733-3p	CLIP-seq
MIRT2469786	hsa-miR-4755-5p	CLIP-seq
MIRT2469787	hsa-miR-4768-5p	CLIP-seq
MIRT2425974	hsa-miR-4770	CLIP-seq
MIRT2469788	hsa-miR-4774-3p	CLIP-seq
MIRT2469789	hsa-miR-4776-5p	CLIP-seq
MIRT2469790	hsa-miR-4786-3p	CLIP-seq
MIRT2425976	hsa-miR-4799-5p	CLIP-seq
MIRT2425977	hsa-miR-4801	CLIP-seq
MIRT2469791	hsa-miR-492	CLIP-seq
MIRT2469792	hsa-miR-495	CLIP-seq
MIRT2469793	hsa-miR-497	CLIP-seq
MIRT2469794	hsa-miR-503	CLIP-seq
MIRT2469795	hsa-miR-512-3p	CLIP-seq
MIRT2425979	hsa-miR-548u	CLIP-seq
MIRT2469796	hsa-miR-576-3p	CLIP-seq
MIRT2425980	hsa-miR-576-5p	CLIP-seq
MIRT2469797	hsa-miR-583	CLIP-seq
MIRT2469798	hsa-miR-620	CLIP-seq
MIRT2469799	hsa-miR-628-5p	CLIP-seq
MIRT2469800	hsa-miR-646	CLIP-seq
MIRT2469801	hsa-miR-653	CLIP-seq
MIRT2469802	hsa-miR-670	CLIP-seq
MIRT2469803	hsa-miR-671-5p	CLIP-seq
MIRT2469804	hsa-miR-761	CLIP-seq
MIRT2469805	hsa-miR-766	CLIP-seq
MIRT2469806	hsa-miR-767-5p	CLIP-seq
MIRT2469807	hsa-miR-874	CLIP-seq
MIRT2469808	hsa-miR-892b	CLIP-seq
MIRT766364	hsa-miR-921	CLIP-seq
MIRT2469809	hsa-miR-922	CLIP-seq
MIRT766326	hsa-let-7a	CLIP-seq
MIRT766327	hsa-let-7b	CLIP-seq
MIRT766328	hsa-let-7c	CLIP-seq
MIRT766329	hsa-let-7d	CLIP-seq
MIRT766330	hsa-let-7e	CLIP-seq
MIRT766331	hsa-let-7f	CLIP-seq
MIRT766332	hsa-let-7g	CLIP-seq
MIRT766333	hsa-let-7i	CLIP-seq
MIRT2469737	hsa-miR-1226	CLIP-seq
MIRT2674414	hsa-miR-1245	CLIP-seq
MIRT2469738	hsa-miR-1248	CLIP-seq
MIRT2469739	hsa-miR-1270	CLIP-seq
MIRT2425950	hsa-miR-1273f	CLIP-seq
MIRT2469740	hsa-miR-1287	CLIP-seq
MIRT2469741	hsa-miR-129-3p	CLIP-seq
MIRT766335	hsa-miR-1294	CLIP-seq
MIRT2469742	hsa-miR-138	CLIP-seq
MIRT2425951	hsa-miR-143	CLIP-seq
MIRT2469743	hsa-miR-1470	CLIP-seq
MIRT2469744	hsa-miR-15a	CLIP-seq
MIRT2469745	hsa-miR-15b	CLIP-seq
MIRT2469746	hsa-miR-16	CLIP-seq
MIRT2469747	hsa-miR-181a	CLIP-seq
MIRT2469748	hsa-miR-181b	CLIP-seq
MIRT2469749	hsa-miR-181c	CLIP-seq
MIRT2469750	hsa-miR-181d	CLIP-seq
MIRT2469751	hsa-miR-193a-3p	CLIP-seq
MIRT2469752	hsa-miR-193b	CLIP-seq
MIRT2425953	hsa-miR-194	CLIP-seq
MIRT2469753	hsa-miR-195	CLIP-seq
MIRT2469754	hsa-miR-197	CLIP-seq
MIRT766336	hsa-miR-202	CLIP-seq
MIRT2425954	hsa-miR-2054	CLIP-seq
MIRT2469755	hsa-miR-214	CLIP-seq
MIRT2674415	hsa-miR-216a	CLIP-seq
MIRT2425956	hsa-miR-302f	CLIP-seq
MIRT2469756	hsa-miR-31	CLIP-seq
MIRT2469757	hsa-miR-3125	CLIP-seq
MIRT2469758	hsa-miR-3128	CLIP-seq
MIRT2469759	hsa-miR-3130-3p	CLIP-seq
MIRT2469760	hsa-miR-3135b	CLIP-seq
MIRT2469761	hsa-miR-3152-5p	CLIP-seq
MIRT2469762	hsa-miR-3157-3p	CLIP-seq
MIRT2469763	hsa-miR-3160-5p	CLIP-seq
MIRT766338	hsa-miR-3161	CLIP-seq
MIRT766339	hsa-miR-3174	CLIP-seq
MIRT2674416	hsa-miR-34a	CLIP-seq
MIRT2674417	hsa-miR-34c-5p	CLIP-seq
MIRT766341	hsa-miR-3606	CLIP-seq
MIRT2469765	hsa-miR-3613-3p	CLIP-seq
MIRT2469766	hsa-miR-3614-3p	CLIP-seq
MIRT2469767	hsa-miR-3619-3p	CLIP-seq
MIRT2469768	hsa-miR-3619-5p	CLIP-seq
MIRT2674418	hsa-miR-3664-5p	CLIP-seq
MIRT2469769	hsa-miR-3667-3p	CLIP-seq
MIRT2674419	hsa-miR-3682-3p	CLIP-seq
MIRT2469770	hsa-miR-3916	CLIP-seq
MIRT2674420	hsa-miR-3921	CLIP-seq
MIRT2425962	hsa-miR-3941	CLIP-seq
MIRT2469771	hsa-miR-409-5p	CLIP-seq
MIRT2469772	hsa-miR-424	CLIP-seq
MIRT766342	hsa-miR-4261	CLIP-seq
MIRT2469773	hsa-miR-4262	CLIP-seq
MIRT2425963	hsa-miR-4263	CLIP-seq
MIRT2674421	hsa-miR-4272	CLIP-seq
MIRT2674422	hsa-miR-4279	CLIP-seq
MIRT2674423	hsa-miR-4286	CLIP-seq
MIRT2469774	hsa-miR-4290	CLIP-seq
MIRT2469775	hsa-miR-4291	CLIP-seq
MIRT2469776	hsa-miR-4312	CLIP-seq
MIRT2469777	hsa-miR-4446-5p	CLIP-seq
MIRT766343	hsa-miR-4458	CLIP-seq
MIRT766344	hsa-miR-4496	CLIP-seq
MIRT2425966	hsa-miR-4499	CLIP-seq
MIRT2674424	hsa-miR-449a	CLIP-seq
MIRT2674425	hsa-miR-449b	CLIP-seq
MIRT766345	hsa-miR-4500	CLIP-seq
MIRT2674426	hsa-miR-4502	CLIP-seq
MIRT2469778	hsa-miR-4524	CLIP-seq
MIRT2469779	hsa-miR-4535	CLIP-seq
MIRT2674427	hsa-miR-4650-3p	CLIP-seq
MIRT2674428	hsa-miR-4653-5p	CLIP-seq
MIRT2425969	hsa-miR-466	CLIP-seq
MIRT2469780	hsa-miR-4663	CLIP-seq
MIRT2469781	hsa-miR-4667-3p	CLIP-seq
MIRT2674429	hsa-miR-4668-3p	CLIP-seq
MIRT2469782	hsa-miR-4670-3p	CLIP-seq
MIRT2425970	hsa-miR-4672	CLIP-seq
MIRT2469783	hsa-miR-4683	CLIP-seq
MIRT2674430	hsa-miR-4695-3p	CLIP-seq
MIRT2425971	hsa-miR-4708-5p	CLIP-seq
MIRT2469784	hsa-miR-4713-5p	CLIP-seq
MIRT2674431	hsa-miR-4714-5p	CLIP-seq
MIRT2425972	hsa-miR-4719	CLIP-seq
MIRT2425973	hsa-miR-4731-3p	CLIP-seq
MIRT2469785	hsa-miR-4733-3p	CLIP-seq
MIRT2469786	hsa-miR-4755-5p	CLIP-seq
MIRT2674432	hsa-miR-4766-5p	CLIP-seq
MIRT2469787	hsa-miR-4768-5p	CLIP-seq
MIRT2425974	hsa-miR-4770	CLIP-seq
MIRT2469788	hsa-miR-4774-3p	CLIP-seq
MIRT2469789	hsa-miR-4776-5p	CLIP-seq
MIRT2469790	hsa-miR-4786-3p	CLIP-seq
MIRT2425976	hsa-miR-4799-5p	CLIP-seq
MIRT2425977	hsa-miR-4801	CLIP-seq
MIRT2469791	hsa-miR-492	CLIP-seq
MIRT2469792	hsa-miR-495	CLIP-seq
MIRT2469793	hsa-miR-497	CLIP-seq
MIRT2469794	hsa-miR-503	CLIP-seq
MIRT2469795	hsa-miR-512-3p	CLIP-seq
MIRT2674433	hsa-miR-543	CLIP-seq
MIRT766349	hsa-miR-548a-5p	CLIP-seq
MIRT766350	hsa-miR-548ab	CLIP-seq
MIRT766351	hsa-miR-548ak	CLIP-seq
MIRT766352	hsa-miR-548b-5p	CLIP-seq
MIRT766353	hsa-miR-548c-5p	CLIP-seq
MIRT766354	hsa-miR-548d-5p	CLIP-seq
MIRT766355	hsa-miR-548h	CLIP-seq
MIRT766356	hsa-miR-548i	CLIP-seq
MIRT766357	hsa-miR-548j	CLIP-seq
MIRT766358	hsa-miR-548k	CLIP-seq
MIRT766359	hsa-miR-548l	CLIP-seq
MIRT2425979	hsa-miR-548u	CLIP-seq
MIRT766360	hsa-miR-548w	CLIP-seq
MIRT766361	hsa-miR-548y	CLIP-seq
MIRT766363	hsa-miR-559	CLIP-seq
MIRT2674434	hsa-miR-568	CLIP-seq
MIRT2469796	hsa-miR-576-3p	CLIP-seq
MIRT2425980	hsa-miR-576-5p	CLIP-seq
MIRT2469797	hsa-miR-583	CLIP-seq
MIRT2469798	hsa-miR-620	CLIP-seq
MIRT2469799	hsa-miR-628-5p	CLIP-seq
MIRT2674435	hsa-miR-633	CLIP-seq
MIRT2469800	hsa-miR-646	CLIP-seq
MIRT2469801	hsa-miR-653	CLIP-seq
MIRT2469802	hsa-miR-670	CLIP-seq
MIRT2469803	hsa-miR-671-5p	CLIP-seq
MIRT2469804	hsa-miR-761	CLIP-seq
MIRT2469805	hsa-miR-766	CLIP-seq
MIRT2469806	hsa-miR-767-5p	CLIP-seq
MIRT2469807	hsa-miR-874	CLIP-seq
MIRT2469808	hsa-miR-892b	CLIP-seq
MIRT766364	hsa-miR-921	CLIP-seq
MIRT2469809	hsa-miR-922	CLIP-seq
MIRT766365	hsa-miR-98	CLIP-seq

Show/Hide all (2)

Transcription factor	Regulation	Reference
ERG	Activation	19396168
EZH2	Repression	22514714

Show/Hide all (31)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001542	Process	Ovulation from ovarian follicle	IEA
GO:0001822	Process	Kidney development	IEA
GO:0004222	Function	Metalloendopeptidase activity	IBA
GO:0004222	Function	Metalloendopeptidase activity	IDA	11278559, 25122765
GO:0004222	Function	Metalloendopeptidase activity	IEA
GO:0005515	Function	Protein binding	IPI	32296183, 32353859, 32814053, 33060197, 36217030
GO:0005576	Component	Extracellular region	IEA
GO:0005604	Component	Basement membrane	IEA
GO:0006508	Process	Proteolysis	IBA
GO:0006508	Process	Proteolysis	IEA
GO:0007229	Process	Integrin-mediated signaling pathway	TAS	8995297
GO:0008201	Function	Heparin binding	IEA
GO:0008233	Function	Peptidase activity	IEA
GO:0008237	Function	Metallopeptidase activity	IEA
GO:0008237	Function	Metallopeptidase activity	TAS	10438512
GO:0008270	Function	Zinc ion binding	IEA
GO:0008285	Process	Negative regulation of cell population proliferation	IEA
GO:0008285	Process	Negative regulation of cell population proliferation	TAS	10438512
GO:0016525	Process	Negative regulation of angiogenesis	IDA	10438512
GO:0016787	Function	Hydrolase activity	IEA
GO:0030198	Process	Extracellular matrix organization	IBA
GO:0030198	Process	Extracellular matrix organization	IEA
GO:0031012	Component	Extracellular matrix	HDA	28327460
GO:0031012	Component	Extracellular matrix	IBA
GO:0031012	Component	Extracellular matrix	IEA
GO:0031410	Component	Cytoplasmic vesicle	IEA
GO:0046872	Function	Metal ion binding	IEA
GO:0060347	Process	Heart trabecula formation	IEA
GO:1900087	Process	Positive regulation of G1/S transition of mitotic cell cycle	IGI	28890348
GO:1904707	Process	Positive regulation of vascular associated smooth muscle cell proliferation	IGI	28890348
GO:1904754	Process	Positive regulation of vascular associated smooth muscle cell migration	IGI	28890348

MIM	HGNC	e!Ensembl
605174	217	ENSG00000154734

Q9UHI8

Protein name

A disintegrin and metalloproteinase with thrombospondin motifs 1 (ADAM-TS 1) (ADAM-TS1) (ADAMTS-1) (EC 3.4.24.-) (METH-1)

Protein function

Metalloprotease which cleaves aggrecan, a cartilage proteoglycan, at the '1938-Glu-|-Leu-1939' site (within the chondroitin sulfate attachment domain), and may be involved in its turnover (By similarity). Also cleaves COMP (PubMed:39672391). Has

PDB

2JIH , 2V4B , 3Q2G , 3Q2H

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF01562	Pep_M12B_propep	48 → 174	Reprolysin family propeptide	Family
PF01421	Reprolysin	258 → 467	Reprolysin (M12B) family zinc metalloprotease	Domain
PF17771	ADAM_CR_2	478 → 546	ADAM cysteine-rich domain	Domain
PF00090	TSP_1	563 → 613	Thrombospondin type 1 domain	Domain
PF05986	ADAM_spacer1	725 → 843	ADAM-TS Spacer 1	Family
PF19030	TSP1_ADAMTS	858 → 909		Domain
PF19030	TSP1_ADAMTS	912 → 966		Domain

Sequence

MQRAVPEGFGRRKLGSDMGNAERAPGSRSFGPVPTLLLLAAALLAVSDALGRPSEEDEEL
VVPELERAPGHGTTRLRLHAFDQQLDLELRPDSSFLAPGFTLQNVGRKSGSETPLPETDL
AHCFYSGTVNGDPSSAAALSLCEGVRGAFYLLGEAYFIQPLPAASERLATAAPGEKPPAP
LQFHLLRRNRQGDVGGTCGVVDDEPRPTGKAETEDEDEGTEGEDEGAQWSPQDPALQGVG
QPTGTGSIRKKRFVSSHRYVETMLVADQSMAEFHGSGLKHYLLTLFSVAARLYKHPSIRN
SVSLVVVKILVIHDEQKGPEVTSNAALTLRNFCNWQKQHNPPSDRDAEHYDTAILFTRQD
LCGSQTCDTLGMADVGTVCDPSRSCSVIEDDGLQAAFTTAHELGHVFNMPHDDAKQCASL
NGVNQDSHMMASMLSNLDHSQPWSPCSAYMITSFLDNGHGECLMDKPQNPIQLPGDLPGT
SYDANRQCQFTFGEDSKHCPDAASTCSTLWCTGTSGGVLVCQTKHFPWADGTSCGEGKWC
INGKCVNKTDRKHFDTPFHGSWGMWGPWGDCSRTCGGGVQYTMRECDNPVPKNGGKYCEG
KRVRYRSCNLEDCPDNNGKTFREEQCEAHNEFSKASFGSGPAVEWIPKYAGVSPKDRCKL
ICQAKGIGYFFVLQPKVVDGTPCSPDSTSVCVQGQCVKAGCDRIIDSKKKFDKCGVCGGN
GSTCKKISGSVTSAKPGYHDIITIPTGATNIEVKQRNQRGSRNNGSFLAIKAADGTYILN
GDYTLSTLEQDIMYKGVVLRYSGSSAALERIRSFSPLKEPLTIQVLTVGNALRPKIKYTY
FVKKKKESFNAIPTFSAWVIEEWGECSKSCELGWQRRLVECRDINGQPASECAKEVKPAS
TRPCADHPCPQWQLGEWSSCSKTCGKGYKKRSLKCLSHDGGVLSHESCDPLKKPKHFIDF
CTMAECS

Sequence length

967

Interactions

View interactions

	Reactome
			Defective B3GALTL causes Peters-plus syndrome (PpS) O-glycosylation of TSR domain-containing proteins

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Causal Diseases (1)

Phenotype Name	Clinical Significance	dbSNP ID	RCV Accession	Evidence Score
Causal Diseases associated with Pathogenic or Likely Pathogenic variants in ClinVar
Premature ovarian failure	Likely pathogenic	rs375553171	RCV001270239	★★★★★ ★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)

Show/Hide Unknown Diseases (13)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
ALZHEIMER DISEASE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ALZHEIMERS DISEASE	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
AUTOSOMAL DOMINANT PROGNATHISM	—	GenCC	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BREAST NEOPLASMS	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CARCINOMA, HEPATOCELLULAR	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CARCINOMA, NON-SMALL-CELL LUNG	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CLASS III MALOCCLUSION	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DEMENTIA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LATE-ONSET ALZHEIMER'S DISEASE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Nonsyndromic hearing impairment	Uncertain significance	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OVARIAN FAILURE, PREMATURE	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Sarcoma	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SCOLIOSIS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (123)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Acromicric Dysplasia	Acromicric Dysplasia	BEFREE	19396027		★★★★★ ★☆☆☆☆ Found in Text Mining only
Acute Confusional Senile Dementia	Senile Dementia	CTD_human_DG	30820047		★★★★★ ★☆☆☆☆ Found in Text Mining only
Alzheimer Disease	Alzheimer disease	Pubtator	32740652	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Alzheimer Disease, Early Onset	Alzheimer disease	CTD_human_DG	30820047		★★★★★ ★☆☆☆☆ Found in Text Mining only
Alzheimer Disease, Late Onset	Alzheimer disease	CTD_human_DG	30820047		★★★★★ ★☆☆☆☆ Found in Text Mining only
Alzheimer`s Disease	Alzheimer disease	CTD_human_DG	30820047		★★★★★ ★☆☆☆☆ Found in Text Mining only
Alzheimer`s Disease, Focal Onset	Alzheimer disease	CTD_human_DG	30820047		★★★★★ ★☆☆☆☆ Found in Text Mining only
Aneurysm	Aneurysm	Pubtator	30979845	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Aortic Aneurysm Thoracic	Thoracic aortic aneurysm	Pubtator	15876810	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Aortic Aneurysm Thoracic	Thoracic aortic aneurysm	Pubtator	23245439	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Aortic Aneurysm, Abdominal	Aortic Aneurysm	BEFREE	28570682		★★★★★ ★☆☆☆☆ Found in Text Mining only
Aortic Diseases	Aortic Diseases	BEFREE	28067899		★★★★★ ★☆☆☆☆ Found in Text Mining only
Aortic Dissection	Aortic dissection	Pubtator	23245439	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Arteriosclerosis	Arteriosclerosis	BEFREE	16641089		★★★★★ ★☆☆☆☆ Found in Text Mining only
Asthma	Asthma	Pubtator	17088949	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Astrocytoma	Astrocytoma	Pubtator	34169995	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Atherosclerosis	Atherosclerosis	BEFREE	16641089		★★★★★ ★☆☆☆☆ Found in Text Mining only
Atherosclerosis	Atherosclerosis	Pubtator	36835545	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Azoospermia	Azoospermia	BEFREE	29737873		★★★★★ ★☆☆☆☆ Found in Text Mining only
Azoospermia, Nonobstructive	Azoospermia	BEFREE	29737873		★★★★★ ★☆☆☆☆ Found in Text Mining only
Benign Prostatic Hyperplasia	Benign Prostatic Hyperplasia	BEFREE	15599946		★★★★★ ★☆☆☆☆ Found in Text Mining only
Bladder Neoplasm	Bladder Neoplasm	BEFREE	29038419		★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	16152618, 23289900, 23681936, 25998153, 28173833, 31135123		★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	CTD_human_DG	23289900		★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	19915008, 22514714, 23289900, 26804550, 28173833	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Carcinogenesis	Carcinogenesis	Pubtator	17167179, 20073072	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	19514085	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma of lung	Lung carcinoma	BEFREE	29118090		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Squamous Cell	Squamous cell carcinoma	Pubtator	24356192	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cardiovascular Diseases	Cardiovascular Diseases	BEFREE	29086015		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cartilage Diseases	Cartilage disease	Pubtator	18671975	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cerebrovascular accident	Stroke	BEFREE	16630594		★★★★★ ★☆☆☆☆ Found in Text Mining only
Class III malocclusion	Malocclusion	BEFREE	26124221		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Colitis Ulcerative	Ulcerative colitis	Pubtator	37798683	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	27859935		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	17167179, 25786261, 27859935	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Conventional (Clear Cell) Renal Cell Carcinoma	Renal Carcinoma	BEFREE	14719095		★★★★★ ★☆☆☆☆ Found in Text Mining only
Coronary Arteriosclerosis	Coronary Arteriosclerosis	BEFREE	18174457		★★★★★ ★☆☆☆☆ Found in Text Mining only
Coronary Artery Disease	Coronary artery disease	BEFREE	18174457		★★★★★ ★☆☆☆☆ Found in Text Mining only
Coronary heart disease	Coronary Heart Disease	BEFREE	18174457		★★★★★ ★☆☆☆☆ Found in Text Mining only
Degenerative polyarthritis	Arthritis	BEFREE	14730609, 27053287		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes	Diabetes	BEFREE	29607651		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes Mellitus	BEFREE	29607651		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Insulin-Dependent	Diabetes Mellitus	BEFREE	21809381		★★★★★ ★☆☆☆☆ Found in Text Mining only
Down Syndrome	Down Syndrome	LHGDN	15661359		★★★★★ ★☆☆☆☆ Found in Text Mining only
Endometrial adenocarcinoma	Endometrial Adenocarcinoma	BEFREE	20840749		★★★★★ ★☆☆☆☆ Found in Text Mining only
Endometrial Carcinoma	Endometrial carcinoma	BEFREE	20840749		★★★★★ ★☆☆☆☆ Found in Text Mining only
Endometrial Neoplasms	Endometrial neoplasm	Pubtator	20840749	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Essential Hypertension	Hypertension	Pubtator	32502021	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Familial Alzheimer Disease (FAD)	Alzheimer disease	CTD_human_DG	30820047		★★★★★ ★☆☆☆☆ Found in Text Mining only
Fibrosarcoma	Fibrosarcoma	BEFREE	29355494		★★★★★ ★☆☆☆☆ Found in Text Mining only
Fibrosis, Liver	Liver Fibrosis	BEFREE	21826695		★★★★★ ★☆☆☆☆ Found in Text Mining only
Gestational Trophoblastic Disease	Gestational trophoblastic disease	Pubtator	24786121	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	BEFREE	24962328		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	Pubtator	24962328, 33396280	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma Multiforme	Glioblastoma	BEFREE	24962328		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	BEFREE	24962328		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	Pubtator	33396280, 34169995	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Heart Diseases	Heart Diseases	BEFREE	30651776		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hyperostosis	Hyperostosis	BEFREE	29366867		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypertensive disease	Hypertension	BEFREE	28803253		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypoxia	Hypoxia	Pubtator	19349275, 30755679	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypoxia	Hypoxia	Pubtator	33396280	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Intervertebral Disc Degeneration	Intervertebral Disc Degeneration	BEFREE	19180493		★★★★★ ★☆☆☆☆ Found in Text Mining only
Intervertebral Disc Degeneration	Intervertebral disc disease	Pubtator	19180493, 21809381	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Intervertebral disc disorder	Intervertebral Disc Disorder	BEFREE	21809381		★★★★★ ★☆☆☆☆ Found in Text Mining only
Kaposi Sarcoma	Kaposi Sarcoma	BEFREE	26675551		★★★★★ ★☆☆☆☆ Found in Text Mining only
Kashin-Beck Disease	Kashin-Beck Disease	BEFREE	27053287		★★★★★ ★☆☆☆☆ Found in Text Mining only
leukemia	Leukemia	BEFREE	21044360		★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia	Leukemia	Pubtator	21044360	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	11705860, 19514085, 26299656		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	CTD_human_DG	19514085		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver neoplasms	Liver neoplasms	BEFREE	26299656		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung Neoplasms	LHGDN	16495931, 19027488		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung neoplasms	Pubtator	20073072	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic metastasis	Pubtator	25936341	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	23289900, 25998153, 28173833, 31135123		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	CTD_human_DG	23289900		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of endometrium	Endometrial Cancer	BEFREE	20840749		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of lung	Lung Cancer	BEFREE	29118090		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of pancreas	Pancreatic cancer	BEFREE	11705860, 24088737, 30953539		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	BEFREE	15599946, 20546609		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of stomach	Stomach Neoplasms	BEFREE	23001403, 25936341		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	18163890, 22514714, 23444028, 25786261, 29179445		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malocclusion	Malocclusion	Pubtator	28257739	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Mammary Carcinoma, Human	Marfan Syndrome	CTD_human_DG	23289900		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	BEFREE	23289900, 23681936		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	CTD_human_DG	23289900		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms, Human	Mammary Neoplasms	CTD_human_DG	23289900		★★★★★ ★☆☆☆☆ Found in Text Mining only
Marfan Syndrome	Marfan Syndrome	BEFREE	28067899, 28712304		★★★★★ ★☆☆☆☆ Found in Text Mining only
Marfan Syndrome	Marfan syndrome	Pubtator	28712304	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Mesothelioma Malignant	Mesothelioma	Pubtator	33800494	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Multiple Sclerosis	Multiple Sclerosis	BEFREE	16900752		★★★★★ ★☆☆☆☆ Found in Text Mining only
Myocardial Infarction	Myocardial infarction	Pubtator	19349275	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Myocardial Infarction	Myocardial Infarction	BEFREE	21037509		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	11705860, 19010931, 19027488, 19514085, 19915008, 20546609, 23001403, 23444028, 23681936, 25936341, 27120788, 30166561, 30953539, 31135123		★★★★★ ★☆☆☆☆ Found in Text Mining only
Non-Small Cell Lung Carcinoma	Lung carcinoma	BEFREE	19027488		★★★★★ ★☆☆☆☆ Found in Text Mining only
Non-Small Cell Lung Carcinoma	Lung carcinoma	CTD_human_DG	19027488		★★★★★ ★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	BEFREE	27447109		★★★★★ ★☆☆☆☆ Found in Text Mining only
Obstructive azoospermia	Obstructive azoospermia	BEFREE	29737873		★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteoarthritis	Osteoarthritis	Pubtator	14730609	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteoarthritis	Osteoarthritis	Pubtator	30655094	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteosarcoma	Osteosarcoma	BEFREE	17560840		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Ovarian neoplasm	Pubtator	26916548, 33161094	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatic carcinoma	Pancreatic carcinoma	BEFREE	11705860, 24088737, 30953539		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasms	Pancreatic neoplasm	Pubtator	24088737, 30953539, 36803844	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Papillary thyroid carcinoma	Papillary thyroid carcinoma	BEFREE	26749005		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pelvic Organ Prolapse	Pelvic organ prolapse	Pubtator	34973089	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Polycystic Ovary Syndrome	Polycystic Ovary Syndrome	BEFREE	24646063, 27908842, 28417352, 29086015, 30446843		★★★★★ ★☆☆☆☆ Found in Text Mining only
Polycystic Ovary Syndrome	Polycystic ovary syndrome	Pubtator	36286390	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Presenile dementia	Senile Dementia	CTD_human_DG	30820047		★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostate carcinoma	Prostate cancer	BEFREE	15599946, 20546609		★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic Neoplasms	LHGDN	15599946		★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic Neoplasms	BEFREE	20546609		★★★★★ ★☆☆☆☆ Found in Text Mining only
Renal Cell Carcinoma	Renal Carcinoma	BEFREE	14719095		★★★★★ ★☆☆☆☆ Found in Text Mining only
Sarcoidosis	Sarcoidosis	Pubtator	33276795	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Schizophrenia	Schizophrenia	Pubtator	33070392	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Carcinoma	Stomach Carcinoma	BEFREE	23001403, 25936341		★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach Neoplasms	BEFREE	23001403, 25936341		★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	25936341, 33015704	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Thyroid Cancer Papillary	Papillary thyroid cancer	Pubtator	26749005	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Urinary Bladder Neoplasms	Urinary bladder neoplasms	Pubtator	29038419	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Uterine Diseases	Uterine polyp	Pubtator	31010360	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only

ADAMTS1 (ADAM metallopeptidase with thrombospondin type 1 motif 1)