PAGE4 (PAGE family member 4)

Gene

• Entrez ID: 9506
• Gene name: PAGE family member 4
• Gene symbol: PAGE4
• Synonyms (NCBI Gene): CT16.7, GAGE-9, GAGEC1, JM-27, JM27, PAGE-1, PAGE-4
• Chromosome: X
• Chromosome location: Xp11.23
• Summary: This gene is a member of the GAGE family. The GAGE genes are expressed in a variety of tumors and in some fetal and reproductive tissues. This gene is strongly expressed in prostate and prostate cancer. It is also expressed in other male and female reprod

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT2431835	hsa-miR-1305	CLIP-seq
MIRT2431836	hsa-miR-3123	CLIP-seq
MIRT2431837	hsa-miR-3671	CLIP-seq
MIRT2431838	hsa-miR-4461	CLIP-seq
MIRT2431839	hsa-miR-607	CLIP-seq

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0003676	Function	Nucleic acid binding	EXP	21357425
GO:0003677	Function	DNA binding	IDA	21357425
GO:0003677	Function	DNA binding	IEA
GO:0003713	Function	Transcription coactivator activity	IDA	24263171, 28289210
GO:0003713	Function	Transcription coactivator activity	IMP	24559171
GO:0005515	Function	Protein binding	IPI	24263171, 24559171, 26242913
GO:0005634	Component	Nucleus	IDA	24559171
GO:0005634	Component	Nucleus	IEA
GO:0005737	Component	Cytoplasm	IDA	12489849, 24559171, 25374899
GO:0005737	Component	Cytoplasm	IEA
GO:0005739	Component	Mitochondrion	IDA	25374899
GO:0005739	Component	Mitochondrion	IEA
GO:0032872	Process	Regulation of stress-activated MAPK cascade	TAS	30658679
GO:0035556	Process	Intracellular signal transduction	IDA	30658679
GO:0042594	Process	Response to starvation	IDA	25374899
GO:0043066	Process	Negative regulation of apoptotic process	IDA	25374899
GO:0043066	Process	Negative regulation of apoptotic process	IMP	21357425
GO:0045893	Process	Positive regulation of DNA-templated transcription	IEA
GO:1903427	Process	Negative regulation of reactive oxygen species biosynthetic process	IDA	25374899

Other IDs

• MIM: 300287
• HGNC: 4108
• e!Ensembl: ENSG00000101951

Protein

• UniProt ID: O60829
• Protein name: P antigen family member 4 (PAGE-4) (G antigen family C member 1) (PAGE-1)
• Protein function: Intrinsically disordered protein that potentiates the transcriptional activator activity of JUN (PubMed:24263171, PubMed:28289210). Protects cells from stress-induced apoptosis by inhibiting reactive oxygen species (ROS) production and via regul
• PDB: 6URQ
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF05831	GAGE	1 → 98	GAGE protein	Family

• Tissue specificity: TISSUE SPECIFICITY: Expressed at basal lvels in the adult normal prostate gland but is highly up-regulated in the fetal prostate and prostate cancer cells (PubMed:12489849, PubMed:24263171, PubMed:24559171, PubMed:25374899). Preferentially expressed in no
• Sequence:

  MSARVRSRSRGRGDGQEAPDVVAFVAPGESQQEEPPTDNQDIEPGQEREGTPPIEERKVE
  GDCQEMDLEKTRSERGDGSDVKEKTPPNPKHAKTKEAGDGQP

• Sequence length: 102

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
PROSTATE CANCER	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PROSTATE CARCINOMA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Benign Prostatic Hyperplasia	Benign Prostatic Hyperplasia	BEFREE	15610763		★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	20010347		★☆☆☆☆ Found in Text Mining only
Congenital arteriovenous malformation	Congenital Arteriovenous Malformation	BEFREE	29878277		★☆☆☆☆ Found in Text Mining only
Germ cell tumor	Tumor	BEFREE	9724777		★☆☆☆☆ Found in Text Mining only
Head and Neck Neoplasms	Head and neck neoplasm	Pubtator	26747525	Associate	★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	BEFREE	11034097, 15610763, 20583133, 21917134, 30658679, 9651357		★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	9724777		★☆☆☆☆ Found in Text Mining only
Prostate carcinoma	Prostate cancer	BEFREE	11034097, 15610763, 20583133, 21917134, 30658679, 9651357		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Prostatic Diseases	Prostatic disease	Pubtator	24559171	Associate	★☆☆☆☆ Found in Text Mining only
Prostatic Hyperplasia	Prostatic hyperplasia	Pubtator	35633887	Associate	★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	11384102, 24263171, 26242913, 29758263, 37565899	Associate	★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	20583133	Stimulate	★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	21917134	Inhibit	★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach Neoplasms	LHGDN	15362791		★☆☆☆☆ Found in Text Mining only