Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	9500
Gene name	MAGE family member D1
Gene symbol	MAGED1
Synonyms (NCBI Gene)	DLXIN-1NRAGE
Chromosome	X
Chromosome location	Xp11.22
Summary	This gene is a member of the melanoma antigen gene (MAGE) family. Most of the genes of this family encode tumor specific antigens that are not expressed in normal adult tissues except testis. Although the protein encoded by this gene shares strong homolog

187

Show/Hide all (187)

miRTarBase ID	miRNA	Experiments	Reference
MIRT042443	hsa-miR-424-5p	CLASH	23622248
MIRT040341	hsa-miR-615-3p	CLASH	23622248
MIRT038660	hsa-let-7g-3p	CLASH	23622248
MIRT036791	hsa-miR-760	CLASH	23622248
MIRT1125718	hsa-miR-1251	CLIP-seq
MIRT1125719	hsa-miR-1252	CLIP-seq
MIRT1125720	hsa-miR-1265	CLIP-seq
MIRT1125721	hsa-miR-1323	CLIP-seq
MIRT1125722	hsa-miR-2277-3p	CLIP-seq
MIRT1125723	hsa-miR-3154	CLIP-seq
MIRT1125724	hsa-miR-421	CLIP-seq
MIRT1125725	hsa-miR-4252	CLIP-seq
MIRT1125726	hsa-miR-4457	CLIP-seq
MIRT1125727	hsa-miR-4474-3p	CLIP-seq
MIRT1125728	hsa-miR-4704-3p	CLIP-seq
MIRT1125729	hsa-miR-4709-5p	CLIP-seq
MIRT1125730	hsa-miR-4731-3p	CLIP-seq
MIRT1125731	hsa-miR-4764-5p	CLIP-seq
MIRT1125732	hsa-miR-4777-5p	CLIP-seq
MIRT1125733	hsa-miR-4801	CLIP-seq
MIRT1125734	hsa-miR-505	CLIP-seq
MIRT1125735	hsa-miR-548o	CLIP-seq
MIRT1125718	hsa-miR-1251	CLIP-seq
MIRT1125719	hsa-miR-1252	CLIP-seq
MIRT1125736	hsa-miR-3120-3p	CLIP-seq
MIRT1125737	hsa-miR-3153	CLIP-seq
MIRT1125723	hsa-miR-3154	CLIP-seq
MIRT1125738	hsa-miR-3200-5p	CLIP-seq
MIRT1125739	hsa-miR-377	CLIP-seq
MIRT1125740	hsa-miR-3908	CLIP-seq
MIRT1125741	hsa-miR-3942-5p	CLIP-seq
MIRT1125742	hsa-miR-411	CLIP-seq
MIRT1125727	hsa-miR-4474-3p	CLIP-seq
MIRT1125743	hsa-miR-4703-5p	CLIP-seq
MIRT1125731	hsa-miR-4764-5p	CLIP-seq
MIRT1125744	hsa-miR-4766-3p	CLIP-seq
MIRT1125732	hsa-miR-4777-5p	CLIP-seq
MIRT1125745	hsa-miR-513a-3p	CLIP-seq
MIRT1125746	hsa-miR-545	CLIP-seq
MIRT1125747	hsa-miR-548u	CLIP-seq
MIRT1125748	hsa-miR-936	CLIP-seq
MIRT1125718	hsa-miR-1251	CLIP-seq
MIRT1125719	hsa-miR-1252	CLIP-seq
MIRT1125720	hsa-miR-1265	CLIP-seq
MIRT1125721	hsa-miR-1323	CLIP-seq
MIRT1125722	hsa-miR-2277-3p	CLIP-seq
MIRT2035515	hsa-miR-2467-5p	CLIP-seq
MIRT1125736	hsa-miR-3120-3p	CLIP-seq
MIRT2035516	hsa-miR-3148	CLIP-seq
MIRT1125737	hsa-miR-3153	CLIP-seq
MIRT1125723	hsa-miR-3154	CLIP-seq
MIRT2035517	hsa-miR-3157-5p	CLIP-seq
MIRT2035518	hsa-miR-3188	CLIP-seq
MIRT1125738	hsa-miR-3200-5p	CLIP-seq
MIRT2035519	hsa-miR-342-3p	CLIP-seq
MIRT1125739	hsa-miR-377	CLIP-seq
MIRT1125740	hsa-miR-3908	CLIP-seq
MIRT1125741	hsa-miR-3942-5p	CLIP-seq
MIRT2035520	hsa-miR-3975	CLIP-seq
MIRT1125742	hsa-miR-411	CLIP-seq
MIRT1125724	hsa-miR-421	CLIP-seq
MIRT1125725	hsa-miR-4252	CLIP-seq
MIRT1125726	hsa-miR-4457	CLIP-seq
MIRT1125727	hsa-miR-4474-3p	CLIP-seq
MIRT2035521	hsa-miR-450b-5p	CLIP-seq
MIRT2035522	hsa-miR-4649-3p	CLIP-seq
MIRT2035523	hsa-miR-4668-5p	CLIP-seq
MIRT1125743	hsa-miR-4703-5p	CLIP-seq
MIRT1125728	hsa-miR-4704-3p	CLIP-seq
MIRT1125729	hsa-miR-4709-5p	CLIP-seq
MIRT1125730	hsa-miR-4731-3p	CLIP-seq
MIRT2035524	hsa-miR-4762-3p	CLIP-seq
MIRT1125731	hsa-miR-4764-5p	CLIP-seq
MIRT1125744	hsa-miR-4766-3p	CLIP-seq
MIRT1125732	hsa-miR-4777-5p	CLIP-seq
MIRT1125733	hsa-miR-4801	CLIP-seq
MIRT2035525	hsa-miR-485-5p	CLIP-seq
MIRT1125734	hsa-miR-505	CLIP-seq
MIRT1125746	hsa-miR-545	CLIP-seq
MIRT1125735	hsa-miR-548o	CLIP-seq
MIRT1125747	hsa-miR-548u	CLIP-seq
MIRT1125748	hsa-miR-936	CLIP-seq
MIRT1125718	hsa-miR-1251	CLIP-seq
MIRT1125719	hsa-miR-1252	CLIP-seq
MIRT1125720	hsa-miR-1265	CLIP-seq
MIRT1125721	hsa-miR-1323	CLIP-seq
MIRT1125722	hsa-miR-2277-3p	CLIP-seq
MIRT1125736	hsa-miR-3120-3p	CLIP-seq
MIRT2035516	hsa-miR-3148	CLIP-seq
MIRT1125737	hsa-miR-3153	CLIP-seq
MIRT1125723	hsa-miR-3154	CLIP-seq
MIRT2035519	hsa-miR-342-3p	CLIP-seq
MIRT1125739	hsa-miR-377	CLIP-seq
MIRT1125740	hsa-miR-3908	CLIP-seq
MIRT1125741	hsa-miR-3942-5p	CLIP-seq
MIRT1125742	hsa-miR-411	CLIP-seq
MIRT1125724	hsa-miR-421	CLIP-seq
MIRT1125725	hsa-miR-4252	CLIP-seq
MIRT1125726	hsa-miR-4457	CLIP-seq
MIRT1125727	hsa-miR-4474-3p	CLIP-seq
MIRT2035523	hsa-miR-4668-5p	CLIP-seq
MIRT1125743	hsa-miR-4703-5p	CLIP-seq
MIRT1125728	hsa-miR-4704-3p	CLIP-seq
MIRT1125729	hsa-miR-4709-5p	CLIP-seq
MIRT1125730	hsa-miR-4731-3p	CLIP-seq
MIRT2035524	hsa-miR-4762-3p	CLIP-seq
MIRT1125731	hsa-miR-4764-5p	CLIP-seq
MIRT1125744	hsa-miR-4766-3p	CLIP-seq
MIRT1125732	hsa-miR-4777-5p	CLIP-seq
MIRT1125733	hsa-miR-4801	CLIP-seq
MIRT1125734	hsa-miR-505	CLIP-seq
MIRT1125746	hsa-miR-545	CLIP-seq
MIRT1125735	hsa-miR-548o	CLIP-seq
MIRT1125747	hsa-miR-548u	CLIP-seq
MIRT1125748	hsa-miR-936	CLIP-seq
MIRT1125721	hsa-miR-1323	CLIP-seq
MIRT1125722	hsa-miR-2277-3p	CLIP-seq
MIRT2035516	hsa-miR-3148	CLIP-seq
MIRT1125726	hsa-miR-4457	CLIP-seq
MIRT2035523	hsa-miR-4668-5p	CLIP-seq
MIRT1125730	hsa-miR-4731-3p	CLIP-seq
MIRT1125733	hsa-miR-4801	CLIP-seq
MIRT1125735	hsa-miR-548o	CLIP-seq
MIRT1125718	hsa-miR-1251	CLIP-seq
MIRT1125720	hsa-miR-1265	CLIP-seq
MIRT1125721	hsa-miR-1323	CLIP-seq
MIRT1125722	hsa-miR-2277-3p	CLIP-seq
MIRT1125736	hsa-miR-3120-3p	CLIP-seq
MIRT2035516	hsa-miR-3148	CLIP-seq
MIRT1125737	hsa-miR-3153	CLIP-seq
MIRT1125739	hsa-miR-377	CLIP-seq
MIRT1125740	hsa-miR-3908	CLIP-seq
MIRT1125741	hsa-miR-3942-5p	CLIP-seq
MIRT1125742	hsa-miR-411	CLIP-seq
MIRT1125724	hsa-miR-421	CLIP-seq
MIRT1125725	hsa-miR-4252	CLIP-seq
MIRT1125726	hsa-miR-4457	CLIP-seq
MIRT1125727	hsa-miR-4474-3p	CLIP-seq
MIRT2035523	hsa-miR-4668-5p	CLIP-seq
MIRT1125743	hsa-miR-4703-5p	CLIP-seq
MIRT1125728	hsa-miR-4704-3p	CLIP-seq
MIRT1125729	hsa-miR-4709-5p	CLIP-seq
MIRT1125730	hsa-miR-4731-3p	CLIP-seq
MIRT1125731	hsa-miR-4764-5p	CLIP-seq
MIRT1125744	hsa-miR-4766-3p	CLIP-seq
MIRT1125732	hsa-miR-4777-5p	CLIP-seq
MIRT1125733	hsa-miR-4801	CLIP-seq
MIRT1125734	hsa-miR-505	CLIP-seq
MIRT1125745	hsa-miR-513a-3p	CLIP-seq
MIRT1125746	hsa-miR-545	CLIP-seq
MIRT1125735	hsa-miR-548o	CLIP-seq
MIRT1125747	hsa-miR-548u	CLIP-seq
MIRT1125748	hsa-miR-936	CLIP-seq
MIRT1125718	hsa-miR-1251	CLIP-seq
MIRT1125719	hsa-miR-1252	CLIP-seq
MIRT1125720	hsa-miR-1265	CLIP-seq
MIRT1125721	hsa-miR-1323	CLIP-seq
MIRT1125722	hsa-miR-2277-3p	CLIP-seq
MIRT2035515	hsa-miR-2467-5p	CLIP-seq
MIRT1125736	hsa-miR-3120-3p	CLIP-seq
MIRT2035516	hsa-miR-3148	CLIP-seq
MIRT1125737	hsa-miR-3153	CLIP-seq
MIRT1125723	hsa-miR-3154	CLIP-seq
MIRT2035518	hsa-miR-3188	CLIP-seq
MIRT1125738	hsa-miR-3200-5p	CLIP-seq
MIRT1125739	hsa-miR-377	CLIP-seq
MIRT2035520	hsa-miR-3975	CLIP-seq
MIRT1125742	hsa-miR-411	CLIP-seq
MIRT1125724	hsa-miR-421	CLIP-seq
MIRT1125725	hsa-miR-4252	CLIP-seq
MIRT1125726	hsa-miR-4457	CLIP-seq
MIRT1125727	hsa-miR-4474-3p	CLIP-seq
MIRT2035522	hsa-miR-4649-3p	CLIP-seq
MIRT2035523	hsa-miR-4668-5p	CLIP-seq
MIRT1125728	hsa-miR-4704-3p	CLIP-seq
MIRT1125729	hsa-miR-4709-5p	CLIP-seq
MIRT1125730	hsa-miR-4731-3p	CLIP-seq
MIRT1125731	hsa-miR-4764-5p	CLIP-seq
MIRT1125732	hsa-miR-4777-5p	CLIP-seq
MIRT1125733	hsa-miR-4801	CLIP-seq
MIRT2035525	hsa-miR-485-5p	CLIP-seq
MIRT1125734	hsa-miR-505	CLIP-seq
MIRT1125745	hsa-miR-513a-3p	CLIP-seq
MIRT1125746	hsa-miR-545	CLIP-seq
MIRT1125735	hsa-miR-548o	CLIP-seq
MIRT1125747	hsa-miR-548u	CLIP-seq
MIRT1125748	hsa-miR-936	CLIP-seq

Show/Hide all (28)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000122	Process	Negative regulation of transcription by RNA polymerase II	IBA
GO:0000785	Component	Chromatin	IEA
GO:0000785	Component	Chromatin	ISS
GO:0003713	Function	Transcription coactivator activity	IEA
GO:0005515	Function	Protein binding	IPI	15930293, 16000308, 20864041, 21516116, 24722188, 25416956, 25910212, 26871637, 31515488, 32296183, 32814053
GO:0005634	Component	Nucleus	IBA
GO:0005634	Component	Nucleus	IEA
GO:0005634	Component	Nucleus	ISS
GO:0005737	Component	Cytoplasm	IEA
GO:0005829	Component	Cytosol	TAS
GO:0005886	Component	Plasma membrane	IEA
GO:0006355	Process	Regulation of DNA-templated transcription	TAS	15930293
GO:0006357	Process	Regulation of transcription by RNA polymerase II	IEA
GO:0016020	Component	Membrane	IEA
GO:0032922	Process	Circadian regulation of gene expression	IEA
GO:0032922	Process	Circadian regulation of gene expression	ISS
GO:0032991	Component	Protein-containing complex	IDA	15930293
GO:0034504	Process	Protein localization to nucleus	IEA
GO:0042752	Process	Regulation of circadian rhythm	IEA
GO:0042802	Function	Identical protein binding	IPI	25416956, 32296183
GO:0042981	Process	Regulation of apoptotic process	TAS	15930293
GO:0045892	Process	Negative regulation of DNA-templated transcription	IEA
GO:0045893	Process	Positive regulation of DNA-templated transcription	IEA
GO:0048511	Process	Rhythmic process	IEA
GO:0050680	Process	Negative regulation of epithelial cell proliferation	IDA	15930293
GO:0090190	Process	Positive regulation of branching involved in ureteric bud morphogenesis	IEA
GO:1900181	Process	Negative regulation of protein localization to nucleus	IEA
GO:2001235	Process	Positive regulation of apoptotic signaling pathway	IEA

MIM	HGNC	e!Ensembl
300224	6813	ENSG00000179222

Q9Y5V3

Protein name

Melanoma-associated antigen D1 (MAGE tumor antigen CCF) (MAGE-D1 antigen) (Neurotrophin receptor-interacting MAGE homolog)

Protein function

Involved in the apoptotic response after nerve growth factor (NGF) binding in neuronal cells. Inhibits cell cycle progression, and facilitates NGFR-mediated apoptosis. May act as a regulator of the function of DLX family members. May enhance ubi

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF01454	MAGE	478 → 645	MAGE family	Family

Tissue specificity

TISSUE SPECIFICITY: Expressed in bone marrow stromal cells from both multiple myeloma patients and healthy donors. Seems to be ubiquitously expressed.

Sequence

MAQKMDCGAGLLGFQAEASVEDSALLMQTLMEAIQISEAPPTNQATAAASPQSSQPPTAN
EMADIQVSAAAARPKSAFKVQNATTKGPNGVYDFSQAHNAKDVPNTQPKAAFKSQNATPK
GPNAAYDFSQAATTGELAANKSEMAFKAQNATTKVGPNATYNFSQSLNANDLANSRPKTP
FKAWNDTTKAPTADTQTQNVNQAKMATSQADIETDPGISEPDGATAQTSADGSQAQNLES
RTIIRGKRTRKINNLNVEENSSGDQRRAPLAAGTWRSAPVPVTTQNPPGAPPNVLWQTPL
AWQNPSGWQNQTARQTPPARQSPPARQTPPAWQNPVAWQNPVIWPNPVIWQNPVIWPNPI
VWPGPVVWPNPLAWQNPPGWQTPPGWQTPPGWQGPPDWQGPPDWPLPPDWPLPPDWPLPT
DWPLPPDWIPADWPIPPDWQNLRPSPNLRPSPNSRASQNPGAAQPRDVALLQERANKLVK
YLMLKDYTKVPIKRSEMLRDIIREYTDVYPEIIERACFVLEKKFGIQLKEIDKEEHLYIL
ISTPESLAGILGTTKDTPKLGLLLVILGVIFMNGNRASEAVLWEALRKMGLRPGVRHPLL
GDLRKLLTYEFVKQKYLDYRRVPNSNPPEYEFLWGLRSYHETSKMKVLRFIAEVQKRDPR
DWTAQFMEAADEALDALDAAAAEAEARAEARTRMGIGDEAVSGPWSWDDIEFELLTWDEE
GDFGDPWSRIPFTFWARYHQNARSRFPQTFAGPIIGPGGTASANFAANFGAIGFFWVE

Sequence length

778

Interactions

View interactions

	KEGG
	Neurotrophin signaling pathway

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (1)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
BELL'S PALSY	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (47)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Anxiety	Anxiety Disorder	BEFREE	22865874		★★★★★ ★☆☆☆☆ Found in Text Mining only
Anxiety Disorders	Anxiety Disorder	BEFREE	22865874		★★★★★ ★☆☆☆☆ Found in Text Mining only
Autistic Disorder	Autism	BEFREE	22865874		★★★★★ ★☆☆☆☆ Found in Text Mining only
B-Cell Lymphomas	B-Cell Lymphoma	BEFREE	31686349		★★★★★ ★☆☆☆☆ Found in Text Mining only
Brain Neoplasms	Brain Neoplasms	BEFREE	21109781		★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	15930293	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	22935435	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinogenesis	Carcinogenesis	Pubtator	15930293	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinogenesis	Carcinogenesis	Pubtator	22935435	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	32941982	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma of lung	Lung carcinoma	BEFREE	28639909		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Renal Cell	Renal cell carcinoma	Pubtator	16082191	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	22935435	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Conventional (Clear Cell) Renal Cell Carcinoma	Renal Carcinoma	BEFREE	16082191		★★★★★ ★☆☆☆☆ Found in Text Mining only
Depressive disorder	Mental Depression	BEFREE	23314527, 24700102		★★★★★ ★☆☆☆☆ Found in Text Mining only
Developmental Disabilities	Developmental disability	Pubtator	28414775	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Esophageal carcinoma	Esophageal Carcinoma	BEFREE	20868560, 26738870, 29516958		★★★★★ ★☆☆☆☆ Found in Text Mining only
Esophageal Neoplasms	Esophageal neoplasm	Pubtator	20868560, 26738870, 29516958	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Esophageal Neoplasms	Esophagus Neoplasm	BEFREE	26738870		★★★★★ ★☆☆☆☆ Found in Text Mining only
Esophageal Squamous Cell Carcinoma	Esophageal squamous cell carcinoma	Pubtator	26738870	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Esophagitis	Esotropia	Pubtator	20868560	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	BEFREE	21109781		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	Pubtator	22935435	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Global developmental delay	Developmental Delay	BEFREE	28414775		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypoxia	Hypoxia	Pubtator	17453828	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Intellectual Disability	Mental retardation	BEFREE	28414775		★★★★★ ★☆☆☆☆ Found in Text Mining only
Intellectual Disability	Intellectual developmental disorder	Pubtator	28414775	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia Myeloid Acute	Myeloid leukemia	Pubtator	37635487	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung neoplasms	Pubtator	28639909	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of esophagus	Esophagus Neoplasm	BEFREE	26738870		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of lung	Lung Cancer	BEFREE	28639909		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of pancreas	Pancreatic cancer	BEFREE	17140727		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	GWASDB_DG	18264097		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	21109781		★★★★★ ★☆☆☆☆ Found in Text Mining only
melanoma	Melanoma	BEFREE	17140727, 9673893		★★★★★ ★☆☆☆☆ Found in Text Mining only
melanoma	Melanoma	LHGDN	17140727		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mental Depression	Mental Depression	BEFREE	23314527, 24700102		★★★★★ ★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Multiple myeloma	Pubtator	33338886	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	21109781, 29516958		★★★★★ ★☆☆☆☆ Found in Text Mining only
Non-Small Cell Lung Carcinoma	Lung carcinoma	BEFREE	28639909		★★★★★ ★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	BEFREE	22865874, 30121577		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatic carcinoma	Pancreatic carcinoma	BEFREE	17140727		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasm	Pancreatic Neoplasm	LHGDN	17140727		★★★★★ ★☆☆☆☆ Found in Text Mining only
Prader-Willi Syndrome	Prader-Willi Syndrome	BEFREE	11782285, 22865874, 23314527		★★★★★ ★☆☆☆☆ Found in Text Mining only
Renal Cell Carcinoma	Renal Carcinoma	BEFREE	16082191		★★★★★ ★☆☆☆☆ Found in Text Mining only
Sarcoma	Sarcoma	Pubtator	34307667	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of esophagus	Esophagus Neoplasm	BEFREE	26738870		★★★★★ ★☆☆☆☆ Found in Text Mining only

MAGED1 (MAGE family member D1)