Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene SNPs miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	949
Gene name	Scavenger receptor class B member 1
Gene symbol	SCARB1
Synonyms (NCBI Gene)	CD36L1CLA-1CLA1HDLCQ6HDLQTL6SR-BISRB1
Chromosome	12
Chromosome location	12q24.31
Summary	The protein encoded by this gene is a plasma membrane receptor for high density lipoprotein cholesterol (HDL). The encoded protein mediates cholesterol transfer to and from HDL. In addition, this protein is a receptor for hepatitis C virus glycoprotein E2

Show/Hide all (1)

SNP ID	Visualize variation	Clinical significance	Consequence
rs74830677	G>A	Pathogenic	Missense variant, intron variant, non coding transcript variant, coding sequence variant

Show/Hide all (89)

miRTarBase ID	miRNA	Experiments	Reference
MIRT035549	hsa-miR-185-5p	Luciferase reporter assay	23459944
MIRT035549	hsa-miR-185-5p	Luciferase reporter assay	23459944
MIRT035549	hsa-miR-185-5p	Luciferase reporter assay	23459944
MIRT035550	hsa-miR-96-5p	Luciferase reporter assay	23459944
MIRT035551	hsa-miR-223-3p	Luciferase reporter assay	23459944
MIRT049705	hsa-miR-92a-3p	CLASH	23622248
MIRT043218	hsa-miR-324-5p	CLASH	23622248
MIRT040078	hsa-miR-615-3p	CLASH	23622248
MIRT037037	hsa-miR-877-3p	CLASH	23622248
MIRT646985	hsa-miR-3610	HITS-CLIP	23824327
MIRT646984	hsa-miR-501-5p	HITS-CLIP	23824327
MIRT646983	hsa-miR-3121-5p	HITS-CLIP	23824327
MIRT646982	hsa-miR-5091	HITS-CLIP	23824327
MIRT646981	hsa-miR-5739	HITS-CLIP	23824327
MIRT646980	hsa-miR-106a-3p	HITS-CLIP	23824327
MIRT646979	hsa-miR-450b-5p	HITS-CLIP	23824327
MIRT646985	hsa-miR-3610	HITS-CLIP	23824327
MIRT646984	hsa-miR-501-5p	HITS-CLIP	23824327
MIRT646983	hsa-miR-3121-5p	HITS-CLIP	23824327
MIRT646982	hsa-miR-5091	HITS-CLIP	23824327
MIRT646981	hsa-miR-5739	HITS-CLIP	23824327
MIRT646980	hsa-miR-106a-3p	HITS-CLIP	23824327
MIRT646979	hsa-miR-450b-5p	HITS-CLIP	23824327
MIRT035550	hsa-miR-96-5p	MicroarrayqRT-PCR	35816043
MIRT1328450	hsa-miR-1227	CLIP-seq
MIRT1328451	hsa-miR-1268	CLIP-seq
MIRT1328452	hsa-miR-1268b	CLIP-seq
MIRT1328453	hsa-miR-19a	CLIP-seq
MIRT1328454	hsa-miR-19b	CLIP-seq
MIRT1328455	hsa-miR-297	CLIP-seq
MIRT1328456	hsa-miR-3665	CLIP-seq
MIRT1328457	hsa-miR-3934	CLIP-seq
MIRT1328458	hsa-miR-3944-5p	CLIP-seq
MIRT1328459	hsa-miR-4685-5p	CLIP-seq
MIRT1328460	hsa-miR-4755-3p	CLIP-seq
MIRT1328461	hsa-miR-567	CLIP-seq
MIRT1328462	hsa-miR-596	CLIP-seq
MIRT1328463	hsa-miR-657	CLIP-seq
MIRT2097484	hsa-miR-1207-5p	CLIP-seq
MIRT2097485	hsa-miR-125a-5p	CLIP-seq
MIRT2097486	hsa-miR-125b	CLIP-seq
MIRT2097487	hsa-miR-1265	CLIP-seq
MIRT2097488	hsa-miR-1910	CLIP-seq
MIRT2097489	hsa-miR-223	CLIP-seq
MIRT2097490	hsa-miR-2392	CLIP-seq
MIRT2097491	hsa-miR-24	CLIP-seq
MIRT2097492	hsa-miR-2964a-5p	CLIP-seq
MIRT2097493	hsa-miR-296-5p	CLIP-seq
MIRT2097494	hsa-miR-3200-5p	CLIP-seq
MIRT2097495	hsa-miR-339-3p	CLIP-seq
MIRT2097496	hsa-miR-3659	CLIP-seq
MIRT2097497	hsa-miR-3677-5p	CLIP-seq
MIRT2097498	hsa-miR-3682-5p	CLIP-seq
MIRT2097499	hsa-miR-3714	CLIP-seq
MIRT2097500	hsa-miR-3918	CLIP-seq
MIRT2097501	hsa-miR-4264	CLIP-seq
MIRT2097502	hsa-miR-4319	CLIP-seq
MIRT2097503	hsa-miR-4328	CLIP-seq
MIRT2097504	hsa-miR-455-3p	CLIP-seq
MIRT2097505	hsa-miR-4658	CLIP-seq
MIRT2097506	hsa-miR-4693-3p	CLIP-seq
MIRT2097507	hsa-miR-4697-3p	CLIP-seq
MIRT2097508	hsa-miR-4732-3p	CLIP-seq
MIRT2097509	hsa-miR-4743	CLIP-seq
MIRT2097510	hsa-miR-4763-3p	CLIP-seq
MIRT2097511	hsa-miR-556-3p	CLIP-seq
MIRT2097512	hsa-miR-574-5p	CLIP-seq
MIRT1328462	hsa-miR-596	CLIP-seq
MIRT2097513	hsa-miR-665	CLIP-seq
MIRT2097514	hsa-miR-670	CLIP-seq
MIRT2097515	hsa-miR-940	CLIP-seq
MIRT2321778	hsa-miR-10a	CLIP-seq
MIRT2321779	hsa-miR-10b	CLIP-seq
MIRT2321780	hsa-miR-1294	CLIP-seq
MIRT2321781	hsa-miR-3184	CLIP-seq
MIRT2097495	hsa-miR-339-3p	CLIP-seq
MIRT2321782	hsa-miR-423-5p	CLIP-seq
MIRT2321783	hsa-miR-4316	CLIP-seq
MIRT2321784	hsa-miR-4447	CLIP-seq
MIRT2321785	hsa-miR-4472	CLIP-seq
MIRT2321786	hsa-miR-4488	CLIP-seq
MIRT2321787	hsa-miR-4651	CLIP-seq
MIRT2321788	hsa-miR-4660	CLIP-seq
MIRT2321789	hsa-miR-4677-3p	CLIP-seq
MIRT2321790	hsa-miR-4680-3p	CLIP-seq
MIRT2321791	hsa-miR-4697-5p	CLIP-seq
MIRT2321792	hsa-miR-486-3p	CLIP-seq
MIRT2321793	hsa-miR-608	CLIP-seq
MIRT2097513	hsa-miR-665	CLIP-seq

Show/Hide all (4)

Transcription factor	Regulation	Reference
NR1H4	Activation	20956002
SPI1	Unknown	8007948
STAT1	Unknown	17998316
STAT2	Unknown	17998316

Show/Hide all (82)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001530	Function	Lipopolysaccharide binding	IDA	12651854
GO:0001540	Function	Amyloid-beta binding	IEA
GO:0001618	Function	Virus receptor activity	IEA
GO:0001786	Function	Phosphatidylserine binding	ISS
GO:0001875	Function	Lipopolysaccharide immune receptor activity	IDA	12651854
GO:0001935	Process	Endothelial cell proliferation	IEA
GO:0005044	Function	Scavenger receptor activity	IBA
GO:0005044	Function	Scavenger receptor activity	TAS	11240025
GO:0005515	Function	Protein binding	IPI	12356718, 14570588, 25416956, 30024968, 32353859, 32814053, 32900848, 33060197, 36217030
GO:0005545	Function	1-phosphatidylinositol binding	TAS	9211901
GO:0005737	Component	Cytoplasm	IEA
GO:0005764	Component	Lysosome	IDA
GO:0005765	Component	Lysosomal membrane	HDA	17897319
GO:0005886	Component	Plasma membrane	IDA	9211901
GO:0005886	Component	Plasma membrane	IEA
GO:0005886	Component	Plasma membrane	TAS
GO:0005901	Component	Caveola	IBA
GO:0005901	Component	Caveola	IEA
GO:0005901	Component	Caveola	TAS	12651854
GO:0006707	Process	Cholesterol catabolic process	IEA
GO:0006869	Process	Lipid transport	IEA
GO:0008035	Function	High-density lipoprotein particle binding	IDA	11792700
GO:0008035	Function	High-density lipoprotein particle binding	IEA
GO:0008289	Function	Lipid binding	IBA
GO:0009986	Component	Cell surface	IBA
GO:0009986	Component	Cell surface	IEA
GO:0009986	Component	Cell surface	ISS	21481393
GO:0010595	Process	Positive regulation of endothelial cell migration	TAS	17574123
GO:0010750	Process	Positive regulation of nitric oxide mediated signal transduction	IDA	11792700
GO:0010867	Process	Positive regulation of triglyceride biosynthetic process	IEA
GO:0010867	Process	Positive regulation of triglyceride biosynthetic process	ISS
GO:0010886	Process	Positive regulation of cholesterol storage	IDA	9211901
GO:0010899	Process	Regulation of phosphatidylcholine catabolic process	IEA
GO:0010899	Process	Regulation of phosphatidylcholine catabolic process	ISS
GO:0015914	Process	Phospholipid transport	IEA
GO:0015914	Process	Phospholipid transport	ISS
GO:0015920	Process	Lipopolysaccharide transport	IDA	12651854
GO:0016020	Component	Membrane	IEA
GO:0030169	Function	Low-density lipoprotein particle binding	IBA
GO:0030169	Function	Low-density lipoprotein particle binding	IDA	9211901
GO:0030301	Process	Cholesterol transport	IEA
GO:0030666	Component	Endocytic vesicle membrane	TAS
GO:0031663	Process	Lipopolysaccharide-mediated signaling pathway	IEA
GO:0032497	Process	Detection of lipopolysaccharide	IDA	12651854
GO:0033344	Process	Cholesterol efflux	IBA
GO:0033344	Process	Cholesterol efflux	IEA
GO:0033344	Process	Cholesterol efflux	IMP	12202492
GO:0033344	Process	Cholesterol efflux	ISS	14718538
GO:0034185	Function	Apolipoprotein binding	IEA
GO:0034185	Function	Apolipoprotein binding	IPI	10764676
GO:0034186	Function	Apolipoprotein A-I binding	IPI	10764676, 12651854
GO:0034375	Process	High-density lipoprotein particle remodeling	IEA
GO:0034375	Process	High-density lipoprotein particle remodeling	ISS
GO:0034381	Process	Plasma lipoprotein particle clearance	IBA
GO:0034383	Process	Low-density lipoprotein particle clearance	IEA
GO:0034383	Process	Low-density lipoprotein particle clearance	ISS
GO:0034384	Process	High-density lipoprotein particle clearance	IDA	9211901, 23459944
GO:0035461	Process	Vitamin transmembrane transport	IMP	11208913
GO:0042060	Process	Wound healing	TAS	17574123
GO:0042311	Process	Vasodilation	IDA	11792700
GO:0042632	Process	Cholesterol homeostasis	IEA
GO:0042632	Process	Cholesterol homeostasis	ISS
GO:0043534	Process	Blood vessel endothelial cell migration	IEA
GO:0043654	Process	Recognition of apoptotic cell	IBA
GO:0043654	Process	Recognition of apoptotic cell	IDA	9211901
GO:0043691	Process	Reverse cholesterol transport	IDA	9211901
GO:0043691	Process	Reverse cholesterol transport	IEA
GO:0044406	Process	Adhesion of symbiont to host	IMP	19087225
GO:0046718	Process	Symbiont entry into host cell	IEA
GO:0050764	Process	Regulation of phagocytosis	IC	9211901
GO:0055097	Process	High density lipoprotein particle mediated signaling	IDA	11792700
GO:0070062	Component	Extracellular exosome	HDA	20458337
GO:0070328	Process	Triglyceride homeostasis	IEA
GO:0070328	Process	Triglyceride homeostasis	ISS
GO:0070506	Function	High-density lipoprotein particle receptor activity	IDA	9211901, 11792700
GO:0070506	Function	High-density lipoprotein particle receptor activity	IMP	11208913
GO:0070508	Process	Cholesterol import	IBA
GO:0070508	Process	Cholesterol import	IEA
GO:0070508	Process	Cholesterol import	IMP	11208913, 26965621
GO:0070508	Process	Cholesterol import	ISS	14718538
GO:0098856	Process	Intestinal lipid absorption	IEA
GO:1902070	Process	Positive regulation of sphingolipid mediated signaling pathway	IDA	11792700

MIM	HGNC	e!Ensembl
601040	1664	ENSG00000073060

Q8WTV0

Protein name

Scavenger receptor class B member 1 (SRB1) (CD36 and LIMPII analogous 1) (CLA-1) (CD36 antigen-like 1) (Collagen type I receptor, thrombospondin receptor-like 1) (SR-BI) (CD antigen CD36)

Protein function

Receptor for different ligands such as phospholipids, cholesterol ester, lipoproteins, phosphatidylserine and apoptotic cells (PubMed:12016218, PubMed:12519372, PubMed:21226579). Receptor for HDL, mediating selective uptake of cholesteryl ether

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF01130	CD36	16 → 463	CD36 family	Family

Tissue specificity

TISSUE SPECIFICITY: Widely expressed.

Sequence

MGCSAKARWAAGALGVAGLLCAVLGAVMIVMVPSLIKQQVLKNVRIDPSSLSFNMWKEIP
IPFYLSVYFFDVMNPSEILKGEKPQVRERGPYVYREFRHKSNITFNNNDTVSFLEYRTFQ
FQPSKSHGSESDYIVMPNILVLGAAVMMENKPMTLKLIMTLAFTTLGERAFMNRTVGEIM
WGYKDPLVNLINKYFPGMFPFKDKFGLFAELNNSDSGLFTVFTGVQNISRIHLVDKWNGL
SKVDFWHSDQCNMINGTSGQMWPPFMTPESSLEFYSPEACRSMKLMYKESGVFEGIPTYR
FVAPKTLFANGSIYPPNEGFCPCLESGIQNVSTCRFSAPLFLSHPHFLNADPVLAEAVTG
LHPNQEAHSLFLDIHPVTGIPMNCSVKLQLSLYMKSVAGIGQTGKIEPVVLPLLWFAESG
AMEGETLHTFYTQLVLMPKVMHYAQYVLLALGCVLLLVPVICQIRSQVGAGQRAARADSH
SLACWGKGASDRTLWPTAAWSPPPAAVLRLCRSGSGHCWGLRSTLASFACRVATTLPVLE
GLGPSLGGGTGS

Sequence length

552

Interactions

View interactions

	KEGG		Reactome
	Virion - Hepatitis viruses Phagosome Ovarian steroidogenesis Aldosterone synthesis and secretion Cortisol synthesis and secretion Cushing syndrome Fat digestion and absorption Bile secretion Vitamin digestion and absorption Cholesterol metabolism Hepatitis C		Scavenging by Class B Receptors HDL clearance

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Causal Diseases (1)

Phenotype Name	Clinical Significance	dbSNP ID	RCV Accession	Evidence Score
Causal Diseases associated with Pathogenic or Likely Pathogenic variants in ClinVar
HIGH DENSITY LIPOPROTEIN CHOLESTEROL LEVEL QUANTITATIVE TRAIT LOCUS 6	Pathogenic	rs201068540	RCV001813912	★★★★★ ★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)

Show/Hide Unknown Diseases (45)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
Acute myeloid leukemia	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Adrenocortical carcinoma, hereditary	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ALZHEIMER DISEASE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CANNABIS ABUSE	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CARCINOMA	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CARCINOMA, RENAL CELL	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Cervical cancer	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Cholangiocarcinoma	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CHOLESTERYL ESTER TRANSFER PROTEIN DEFICIENCY	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CHRONIC KIDNEY DISEASE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Clear cell carcinoma of kidney	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CLEAR CELL RENAL CARCINOMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CORONARY ARTERY DISEASE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CORONARY ATHEROSCLEROSIS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
FAMILIAL HYPERALPHALIPOPROTEINEMIA	—	Orphanet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
FOLLICULAR CYST	—	CTD, Disgenet CTD, Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Gastric cancer	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HEART DISEASE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HEART FAILURE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HEPATITIS C	—	CTD, Disgenet CTD, Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HYPERLIPIDEMIA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HYPERTENSIVE HEART DISEASE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HYPERTENSIVE NEPHROPATHY	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
KIDNEY CANCER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
KIDNEY DISEASE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
KIDNEY FAILURE, CHRONIC	—	CTD, Disgenet CTD, Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Lung cancer	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Malignant lymphoma, large B-cell, diffuse	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MALUNION FRACTURE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Melanoma	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
METABOLIC DISEASE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
METABOLIC SYNDROME	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MYOCARDIAL INFARCTION	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MYOCARDIAL ISCHEMIA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
NEUROTIC DISORDER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
NON-ALCOHOLIC FATTY LIVER DISEASE	—	CTD, Disgenet CTD, Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
NONALCOHOLIC STEATOHEPATITIS	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OVARIAN FAILURE, PREMATURE	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Ovarian serous cystadenocarcinoma	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Sarcoma	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SCARB1-related disorder	Benign; Likely benign; Conflicting classifications of pathogenicity; Uncertain significance	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Thymoma	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TYPE 2 DIABETES MELLITUS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Uterine carcinosarcoma	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Uterine corpus endometrial carcinoma	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (142)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Acute Coronary Syndrome	Coronary Syndrome	GWASCAT_DG	28753643		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenoma	Adenoma	BEFREE	10426565		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adrenal Cortical Adenoma	Adrenocortical adenoma	BEFREE	9253328		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adrenal Gland Pheochromocytoma	Adrenal Gland Pheochromocytoma	BEFREE	10426565, 30049837, 30300539, 9253328		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adrenocortical Carcinoma	Adrenocortical carcinoma	Pubtator	10426565	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Adrenocortical carcinoma	Adrenocortical carcinoma	BEFREE	9253328		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adult Medulloblastoma	Medulloblastoma	BEFREE	29352211		★★★★★ ★☆☆☆☆ Found in Text Mining only
Age related macular degeneration	Age-related macular degeneration	BEFREE	19806217, 24346170, 27428740		★★★★★ ★☆☆☆☆ Found in Text Mining only
Alagille Syndrome	Alagille syndrome	Pubtator	15210845	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Alzheimer`s Disease	Alzheimer disease	GWASCAT_DG	30805717		★★★★★ ★☆☆☆☆ Found in Text Mining only
Anaplastic carcinoma	Anaplastic Carcinoma	CTD_human_DG	12376462		★★★★★ ★☆☆☆☆ Found in Text Mining only
Arteriosclerosis	Arteriosclerosis	BEFREE	10865830, 11111095, 12238639, 16501936, 17259591, 17272756, 20160195, 22628436, 23041084, 25964513, 25993026, 26965621, 28134663, 31733201, 31784656		★★★★★ ★☆☆☆☆ Found in Text Mining only
Arthritis	Arthritis	Pubtator	22076945	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Arthritis Rheumatoid	Rheumatoid arthritis	Pubtator	20304957	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Ataxia Telangiectasia	Ataxia telangiectasia	Pubtator	24405662	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Atherosclerosis	Atherosclerosis	BEFREE	10865830, 11111095, 12238639, 16501936, 17259591, 17272756, 20160195, 22628436, 23041084, 25964513, 25993026, 26965621, 28134663, 31733201, 31784656		★★★★★ ★☆☆☆☆ Found in Text Mining only
Atherosclerosis	Atherosclerosis	Pubtator	12238639, 16122381, 17587765, 20057170, 20160195, 22628436, 24713582, 27225585, 27651445, 27777974, 30289950, 31858876	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Atherosclerosis	Atherosclerosis	LHGDN	16777453, 17957039		★★★★★ ★☆☆☆☆ Found in Text Mining only
Atherosclerosis	Atherosclerosis	Pubtator	17957039	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Blast Crisis	Blast crisis	Pubtator	19654405	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	26456958	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinogenesis	Carcinogenesis	Pubtator	29357836, 36735267	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma	Carcinoma	CTD_human_DG	12376462		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	18000990, 19776133, 29430178	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Large Cell	Large cell carcinoma	Pubtator	28993508	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Pancreatic Ductal	Pancreatic ductal carcinoma	Pubtator	27002321	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Renal Cell	Renal cell carcinoma	Pubtator	21131975, 25945350, 29357836, 30173145, 33608777, 37801479	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Renal Cell	Renal cell carcinoma	Pubtator	28466781	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma, Spindle-Cell	Carcinoma	CTD_human_DG	12376462		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cardiomyopathies	Cardiomyopathy	BEFREE	29976771		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cardiovascular Diseases	Cardiovascular Diseases	BEFREE	20064494, 22628436, 28134663, 28882953, 30289950, 31251897		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cardiovascular Diseases	Cardiovascular disease	Pubtator	22628436, 30289950	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cardiovascular Diseases	Cardiovascular disease	Pubtator	28882953	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cerebral Infarction	Ischemic stroke	Pubtator	24151447	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cerebral Infarction	Cerebral Infarction	BEFREE	28552715		★★★★★ ★☆☆☆☆ Found in Text Mining only
Childhood Medulloblastoma	Medulloblastoma	BEFREE	29352211		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cholesteryl Ester Transfer Protein Deficiency	Hyperalphalipoproteinemia	BEFREE	19158204		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Chromophobe Renal Cell Carcinoma	Chromophobe Carcinoma	CTD_human_DG	21131975		★★★★★ ★☆☆☆☆ Found in Text Mining only
Chronic Obstructive Airway Disease	Chronic Obstructive Pulmonary Disease	BEFREE	25766837		★★★★★ ★☆☆☆☆ Found in Text Mining only
Collecting Duct Carcinoma of the Kidney	Renal Carcinoma	CTD_human_DG	21131975		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colonic Neoplasms	Colonic neoplasm	Pubtator	17959672	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Conn Syndrome	Conn Syndrome	BEFREE	10426565		★★★★★ ★☆☆☆☆ Found in Text Mining only
Conventional (Clear Cell) Renal Cell Carcinoma	Renal Carcinoma	CTD_human_DG	21131975		★★★★★ ★☆☆☆☆ Found in Text Mining only
Conventional (Clear Cell) Renal Cell Carcinoma	Renal Carcinoma	BEFREE	25945350		★★★★★ ★☆☆☆☆ Found in Text Mining only
Coronary Arteriosclerosis	Coronary Arteriosclerosis	BEFREE	12771386, 25993026, 28552715, 29596577, 30103009, 30289950		★★★★★ ★☆☆☆☆ Found in Text Mining only
Coronary Artery Disease	Coronary artery disease	LHGDN	12807968		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Coronary Artery Disease	Coronary artery disease	GWASDB_DG	23202125		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Coronary Artery Disease	Coronary artery disease	BEFREE	23510561, 24082102, 24151447, 25993026, 28552715, 29596577, 30103009, 30289950		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Coronary Artery Disease	Coronary artery disease	Pubtator	23510561, 24151447, 26754576, 28209224, 28882953, 29596577, 30289950	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Coronary Artery Disease	Coronary artery disease	GWASCAT_DG	28714975, 29212778		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Coronary Disease	Coronary artery disease	Pubtator	27166935, 27777974, 34881703	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Coronary heart disease	Coronary Heart Disease	BEFREE	12771386, 15681296, 22003152, 25993026, 28552715, 29596577, 30103009, 30289950		★★★★★ ★☆☆☆☆ Found in Text Mining only
Coronary heart disease	Coronary Heart Disease	GWASCAT_DG	28753643		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cushing Syndrome	Cushing`s Syndrome	BEFREE	10426565		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cushing Syndrome	Cushing syndrome	Pubtator	10426565	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes	Diabetes	BEFREE	17618962		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Complications	Diabetes complications	Pubtator	35806251	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes Mellitus	BEFREE	17618962		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes mellitus	Pubtator	17957039	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes mellitus	Pubtator	19276229	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus Type 2	Diabetes mellitus, type 2	Pubtator	19276229, 35299814	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Non-Insulin-Dependent	Diabetes Mellitus	BEFREE	12788901, 15671101, 19276229		★★★★★ ★☆☆☆☆ Found in Text Mining only
Dyslipidemias	Dyslipidemias	BEFREE	16501936, 17700364, 23919842		★★★★★ ★☆☆☆☆ Found in Text Mining only
Dyslipidemias	Dyslipidemias	Pubtator	28315561, 34881703	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Exencephaly	Anencephaly	BEFREE	23221804		★★★★★ ★☆☆☆☆ Found in Text Mining only
Follicular cyst	Follicular Cyst	CTD_human_DG	20404351		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Follicular thyroid carcinoma	Follicular Thyroid Carcinoma	BEFREE	27207655		★★★★★ ★☆☆☆☆ Found in Text Mining only
Gallstones	Gallstones	Pubtator	18007013	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Glycogen Storage Disease	Glycogen Storage Disease	LHGDN	16777453		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hashimoto Disease	Hashimoto Disease	BEFREE	24007717		★★★★★ ★☆☆☆☆ Found in Text Mining only
Heart Diseases	Heart Diseases	LHGDN	15681296		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hepatitis C	Hepatitis c	Pubtator	18000990, 20949066, 36415047	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hyperaldosteronism	Hyperaldosteronism	Pubtator	10426565	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypercholesterolemia	Hypercholesterolemia	BEFREE	12771386, 20064494, 23510561, 30354229, 31138790		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypercholesterolemia	Hypercholesterolemia	Pubtator	23510561	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypercholesterolemia	Hypercholesterolemia	GENOMICS_ENGLAND_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Hyperglycemia	Hyperglycemia	Pubtator	17957039	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypospadias	Hypospadias	BEFREE	22906644		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypospadias	Hypospadias	Pubtator	22906644	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypoxia	Hypoxia	Pubtator	16122381	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Insulin Resistance	Diabetes mellitus, type 2	Pubtator	19276229, 35806251	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Ischemic cardiomyopathy	Ischemic myocardial dysfunction	BEFREE	30867376		★★★★★ ★☆☆☆☆ Found in Text Mining only
Kidney Failure, Chronic	Kidney Failure	CTD_human_DG	19878707		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Large cell carcinoma of lung	Lung Carcinoma	BEFREE	28993508		★★★★★ ★☆☆☆☆ Found in Text Mining only
LEUKOENCEPHALOPATHY, BRAIN CALCIFICATIONS, AND CYSTS	LEUKOENCEPHALOPATHY, BRAIN CALCIFICATIONS, AND CYSTS	BEFREE	28993508		★★★★★ ★☆☆☆☆ Found in Text Mining only
Leydig Cell Tumor	Leydig Cell Tumor	BEFREE	9253328		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	17259591, 28993508		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver Cirrhosis	Liver cirrhosis	Pubtator	36415047	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver neoplasms	Liver neoplasms	BEFREE	17259591		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung neoplasms	Pubtator	28993508	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus, Systemic	Lupus Erythematosus	GWASCAT_DG	26980576		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lupus Nephritis	Lupus Nephritis	GWASCAT_DG	26980576		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic metastasis	Pubtator	26456958	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphoma	Lymphoma	Pubtator	36436934	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Macular Degeneration	Macular degeneration	Pubtator	19806217, 23562302, 24346170	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	BEFREE	26251134		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	16603078, 28595267		★★★★★ ★☆☆☆☆ Found in Text Mining only
Medullary carcinoma of thyroid	Megalencephaly, Polymicrogyria, Polydactyly, Hydrocephalus Syndrome	BEFREE	30049837, 30300539		★★★★★ ★☆☆☆☆ Found in Text Mining only
Medulloblastoma	Medulloblastoma	BEFREE	29352211		★★★★★ ★☆☆☆☆ Found in Text Mining only
melanoma	Melanoma	BEFREE	28974560		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Melanoma	Melanoma	Pubtator	30823658	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Melanoma Cutaneous Malignant	Melanoma	Pubtator	37801479	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Metabolic Syndrome X	Metabolic Syndrome	BEFREE	22182283		★★★★★ ★☆☆☆☆ Found in Text Mining only
Metastatic melanoma	Metastatic Melanoma	BEFREE	28974560		★★★★★ ★☆☆☆☆ Found in Text Mining only
Myocardial Infarction	Myocardial infarction	Pubtator	22628436, 23510561, 34881703	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Myocardial Infarction	Myocardial Infarction	BEFREE	23510561, 30867376		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Nasopharyngeal Carcinoma	Nasopharyngeal carcinoma	Pubtator	27071030, 37009875	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	10426565, 28919755, 31289363		★★★★★ ★☆☆☆☆ Found in Text Mining only
Niemann-Pick Disease, Type C	Niemann-Pick Disease	BEFREE	22425645		★★★★★ ★☆☆☆☆ Found in Text Mining only
Non-alcoholic Fatty Liver Disease	Non-Alcoholic Fatty Liver Disease	CTD_human_DG	23127599		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Nonalcoholic Steatohepatitis	Non-alcoholic Fatty Liver Disease	CTD_human_DG	23127599		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Obesity	Obesity	BEFREE	19223519		★★★★★ ★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	Pubtator	23039238, 23109900, 30659447	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Ovarian neoplasm	Pubtator	33608777	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasms	Pancreatic neoplasm	Pubtator	27002321	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Papillary Renal Cell Carcinoma	Papillary Renal Carcinoma	CTD_human_DG	21131975		★★★★★ ★☆☆☆☆ Found in Text Mining only
Penile hypospadias	Penile Hypospadias	BEFREE	22906644		★★★★★ ★☆☆☆☆ Found in Text Mining only
Peripheral Arterial Diseases	Vascular Diseases	BEFREE	17618962		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pheochromocytoma	Pheochromocytoma	BEFREE	10426565, 30049837, 30300539, 9253328		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pheochromocytoma	Pheochromocytoma	Pubtator	10426565	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostate carcinoma	Prostate cancer	BEFREE	26251134		★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	18782595, 24623848	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	26251134	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Pseudohyperkalemia Cardiff	Pseudohyperkalemia Cardiff	BEFREE	27561198, 28827115		★★★★★ ★☆☆☆☆ Found in Text Mining only
Psoriasis	Psoriasis	BEFREE	29321372		★★★★★ ★☆☆☆☆ Found in Text Mining only
Renal Cell Carcinoma	Renal Carcinoma	GWASCAT_DG	21131975, 28598434		★★★★★ ★☆☆☆☆ Found in Text Mining only
Renal Cell Carcinoma	Renal Carcinoma	CTD_human_DG	21131975		★★★★★ ★☆☆☆☆ Found in Text Mining only
Renal Cell Carcinoma	Renal Carcinoma	GWASDB_DG	21131975		★★★★★ ★☆☆☆☆ Found in Text Mining only
Rett Syndrome	Rett syndrome	Pubtator	23711372, 26006105	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Rett Syndrome	Rett Syndrome	BEFREE	25118178, 26006105		★★★★★ ★☆☆☆☆ Found in Text Mining only
Sarcomatoid Renal Cell Carcinoma	Renal Carcinoma	CTD_human_DG	21131975		★★★★★ ★☆☆☆☆ Found in Text Mining only
Sebaceous Gland Neoplasms	Sebaceous gland neoplasms	Pubtator	36735267	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Senile Plaques	Senile Plaques	BEFREE	30319394		★★★★★ ★☆☆☆☆ Found in Text Mining only
Small cell carcinoma of lung	Lung carcinoma	BEFREE	28993508		★★★★★ ★☆☆☆☆ Found in Text Mining only
Small Cell Lung Carcinoma	Small cell lung carcinoma	Pubtator	28993508	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma	Carcinoma	BEFREE	16603078		★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	27893427, 37279381	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Thyroid Cancer Papillary	Papillary thyroid cancer	Pubtator	27207655	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Thyroid cancer, follicular	Thyroid cancer	BEFREE	27207655		★★★★★ ★☆☆☆☆ Found in Text Mining only
Undifferentiated carcinoma	Carcinoma	CTD_human_DG	12376462		★★★★★ ★☆☆☆☆ Found in Text Mining only
Vascular Diseases	Vascular disease	Pubtator	14730480	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Vitiligo	Vitiligo	Pubtator	36890149	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only

SCARB1 (scavenger receptor class B member 1)