Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	9481
Gene name	Solute carrier family 25 member 27
Gene symbol	SLC25A27
Synonyms (NCBI Gene)	UCP4
Chromosome	6
Chromosome location	6p12.3
Summary	Mitochondrial uncoupling proteins (UCP) are members of the larger family of mitochondrial anion carrier proteins (MACP). UCPs separate oxidative phosphorylation from ATP synthesis with energy dissipated as heat, also referred to as the mitochondrial proto

152

Show/Hide all (152)

miRTarBase ID	miRNA	Experiments	Reference
MIRT509160	hsa-miR-369-3p	HITS-CLIP	21572407
MIRT509159	hsa-miR-5692b	HITS-CLIP	21572407
MIRT509158	hsa-miR-5692c	HITS-CLIP	21572407
MIRT509157	hsa-miR-410-3p	HITS-CLIP	21572407
MIRT509156	hsa-miR-5011-5p	HITS-CLIP	21572407
MIRT707273	hsa-miR-6792-5p	HITS-CLIP	21572407
MIRT509155	hsa-miR-374a-5p	HITS-CLIP	21572407
MIRT509154	hsa-miR-374b-5p	HITS-CLIP	21572407
MIRT509153	hsa-miR-190a-3p	HITS-CLIP	21572407
MIRT707272	hsa-miR-4503	HITS-CLIP	21572407
MIRT509152	hsa-miR-1277-5p	HITS-CLIP	21572407
MIRT509160	hsa-miR-369-3p	HITS-CLIP	21572407
MIRT509159	hsa-miR-5692b	HITS-CLIP	21572407
MIRT509158	hsa-miR-5692c	HITS-CLIP	21572407
MIRT509157	hsa-miR-410-3p	HITS-CLIP	21572407
MIRT509156	hsa-miR-5011-5p	HITS-CLIP	21572407
MIRT509155	hsa-miR-374a-5p	HITS-CLIP	21572407
MIRT509154	hsa-miR-374b-5p	HITS-CLIP	21572407
MIRT509153	hsa-miR-190a-3p	HITS-CLIP	21572407
MIRT509152	hsa-miR-1277-5p	HITS-CLIP	21572407
MIRT509160	hsa-miR-369-3p	HITS-CLIP	23313552
MIRT509159	hsa-miR-5692b	HITS-CLIP	23313552
MIRT509158	hsa-miR-5692c	HITS-CLIP	23313552
MIRT509157	hsa-miR-410-3p	HITS-CLIP	23313552
MIRT509156	hsa-miR-5011-5p	HITS-CLIP	23313552
MIRT509155	hsa-miR-374a-5p	HITS-CLIP	23313552
MIRT509154	hsa-miR-374b-5p	HITS-CLIP	23313552
MIRT509153	hsa-miR-190a-3p	HITS-CLIP	23313552
MIRT509152	hsa-miR-1277-5p	HITS-CLIP	23313552
MIRT509160	hsa-miR-369-3p	HITS-CLIP	23824327
MIRT509159	hsa-miR-5692b	HITS-CLIP	23824327
MIRT509158	hsa-miR-5692c	HITS-CLIP	23824327
MIRT509157	hsa-miR-410-3p	HITS-CLIP	23824327
MIRT509156	hsa-miR-5011-5p	HITS-CLIP	23824327
MIRT509155	hsa-miR-374a-5p	HITS-CLIP	23824327
MIRT509154	hsa-miR-374b-5p	HITS-CLIP	23824327
MIRT509153	hsa-miR-190a-3p	HITS-CLIP	23824327
MIRT509152	hsa-miR-1277-5p	HITS-CLIP	23824327
MIRT509152	hsa-miR-1277-5p	PAR-CLIP	21572407
MIRT509160	hsa-miR-369-3p	PAR-CLIP	21572407
MIRT509159	hsa-miR-5692b	PAR-CLIP	21572407
MIRT509158	hsa-miR-5692c	PAR-CLIP	21572407
MIRT509157	hsa-miR-410-3p	PAR-CLIP	21572407
MIRT509156	hsa-miR-5011-5p	PAR-CLIP	21572407
MIRT509155	hsa-miR-374a-5p	PAR-CLIP	21572407
MIRT509154	hsa-miR-374b-5p	PAR-CLIP	21572407
MIRT509153	hsa-miR-190a-3p	PAR-CLIP	21572407
MIRT509160	hsa-miR-369-3p	PAR-CLIP	21572407
MIRT509159	hsa-miR-5692b	PAR-CLIP	21572407
MIRT509158	hsa-miR-5692c	PAR-CLIP	21572407
MIRT509157	hsa-miR-410-3p	PAR-CLIP	21572407
MIRT509156	hsa-miR-5011-5p	PAR-CLIP	21572407
MIRT509155	hsa-miR-374a-5p	PAR-CLIP	21572407
MIRT509154	hsa-miR-374b-5p	PAR-CLIP	21572407
MIRT509153	hsa-miR-190a-3p	PAR-CLIP	21572407
MIRT509152	hsa-miR-1277-5p	PAR-CLIP	21572407
MIRT509160	hsa-miR-369-3p	PAR-CLIP	23446348
MIRT509159	hsa-miR-5692b	PAR-CLIP	23446348
MIRT509158	hsa-miR-5692c	PAR-CLIP	23446348
MIRT509157	hsa-miR-410-3p	PAR-CLIP	23446348
MIRT509156	hsa-miR-5011-5p	PAR-CLIP	23446348
MIRT509155	hsa-miR-374a-5p	PAR-CLIP	23446348
MIRT509154	hsa-miR-374b-5p	PAR-CLIP	23446348
MIRT509153	hsa-miR-190a-3p	PAR-CLIP	23446348
MIRT509152	hsa-miR-1277-5p	PAR-CLIP	23446348
MIRT509160	hsa-miR-369-3p	PAR-CLIP	23446348
MIRT509159	hsa-miR-5692b	PAR-CLIP	23446348
MIRT509158	hsa-miR-5692c	PAR-CLIP	23446348
MIRT509157	hsa-miR-410-3p	PAR-CLIP	23446348
MIRT509156	hsa-miR-5011-5p	PAR-CLIP	23446348
MIRT509155	hsa-miR-374a-5p	PAR-CLIP	23446348
MIRT509154	hsa-miR-374b-5p	PAR-CLIP	23446348
MIRT509153	hsa-miR-190a-3p	PAR-CLIP	23446348
MIRT509152	hsa-miR-1277-5p	PAR-CLIP	23446348
MIRT509160	hsa-miR-369-3p	HITS-CLIP	21572407
MIRT509159	hsa-miR-5692b	HITS-CLIP	21572407
MIRT509158	hsa-miR-5692c	HITS-CLIP	21572407
MIRT509157	hsa-miR-410-3p	HITS-CLIP	21572407
MIRT509156	hsa-miR-5011-5p	HITS-CLIP	21572407
MIRT707273	hsa-miR-6792-5p	HITS-CLIP	21572407
MIRT509155	hsa-miR-374a-5p	HITS-CLIP	21572407
MIRT509154	hsa-miR-374b-5p	HITS-CLIP	21572407
MIRT509153	hsa-miR-190a-3p	HITS-CLIP	21572407
MIRT707272	hsa-miR-4503	HITS-CLIP	21572407
MIRT509152	hsa-miR-1277-5p	HITS-CLIP	21572407
MIRT509160	hsa-miR-369-3p	HITS-CLIP	21572407
MIRT509159	hsa-miR-5692b	HITS-CLIP	21572407
MIRT509158	hsa-miR-5692c	HITS-CLIP	21572407
MIRT509157	hsa-miR-410-3p	HITS-CLIP	21572407
MIRT509156	hsa-miR-5011-5p	HITS-CLIP	21572407
MIRT509155	hsa-miR-374a-5p	HITS-CLIP	21572407
MIRT509154	hsa-miR-374b-5p	HITS-CLIP	21572407
MIRT509153	hsa-miR-190a-3p	HITS-CLIP	21572407
MIRT509152	hsa-miR-1277-5p	HITS-CLIP	21572407
MIRT509160	hsa-miR-369-3p	HITS-CLIP	23313552
MIRT509159	hsa-miR-5692b	HITS-CLIP	23313552
MIRT509158	hsa-miR-5692c	HITS-CLIP	23313552
MIRT509157	hsa-miR-410-3p	HITS-CLIP	23313552
MIRT509156	hsa-miR-5011-5p	HITS-CLIP	23313552
MIRT509155	hsa-miR-374a-5p	HITS-CLIP	23313552
MIRT509154	hsa-miR-374b-5p	HITS-CLIP	23313552
MIRT509153	hsa-miR-190a-3p	HITS-CLIP	23313552
MIRT509152	hsa-miR-1277-5p	HITS-CLIP	23313552
MIRT509160	hsa-miR-369-3p	HITS-CLIP	23824327
MIRT509159	hsa-miR-5692b	HITS-CLIP	23824327
MIRT509158	hsa-miR-5692c	HITS-CLIP	23824327
MIRT509157	hsa-miR-410-3p	HITS-CLIP	23824327
MIRT509156	hsa-miR-5011-5p	HITS-CLIP	23824327
MIRT509155	hsa-miR-374a-5p	HITS-CLIP	23824327
MIRT509154	hsa-miR-374b-5p	HITS-CLIP	23824327
MIRT509153	hsa-miR-190a-3p	HITS-CLIP	23824327
MIRT509152	hsa-miR-1277-5p	HITS-CLIP	23824327
MIRT509152	hsa-miR-1277-5p	PAR-CLIP	21572407
MIRT509160	hsa-miR-369-3p	PAR-CLIP	21572407
MIRT509159	hsa-miR-5692b	PAR-CLIP	21572407
MIRT509158	hsa-miR-5692c	PAR-CLIP	21572407
MIRT509157	hsa-miR-410-3p	PAR-CLIP	21572407
MIRT509156	hsa-miR-5011-5p	PAR-CLIP	21572407
MIRT509155	hsa-miR-374a-5p	PAR-CLIP	21572407
MIRT509154	hsa-miR-374b-5p	PAR-CLIP	21572407
MIRT509153	hsa-miR-190a-3p	PAR-CLIP	21572407
MIRT509160	hsa-miR-369-3p	PAR-CLIP	21572407
MIRT509159	hsa-miR-5692b	PAR-CLIP	21572407
MIRT509158	hsa-miR-5692c	PAR-CLIP	21572407
MIRT509157	hsa-miR-410-3p	PAR-CLIP	21572407
MIRT509156	hsa-miR-5011-5p	PAR-CLIP	21572407
MIRT509155	hsa-miR-374a-5p	PAR-CLIP	21572407
MIRT509154	hsa-miR-374b-5p	PAR-CLIP	21572407
MIRT509153	hsa-miR-190a-3p	PAR-CLIP	21572407
MIRT509152	hsa-miR-1277-5p	PAR-CLIP	21572407
MIRT509160	hsa-miR-369-3p	PAR-CLIP	23446348
MIRT509159	hsa-miR-5692b	PAR-CLIP	23446348
MIRT509158	hsa-miR-5692c	PAR-CLIP	23446348
MIRT509157	hsa-miR-410-3p	PAR-CLIP	23446348
MIRT509156	hsa-miR-5011-5p	PAR-CLIP	23446348
MIRT509155	hsa-miR-374a-5p	PAR-CLIP	23446348
MIRT509154	hsa-miR-374b-5p	PAR-CLIP	23446348
MIRT509153	hsa-miR-190a-3p	PAR-CLIP	23446348
MIRT509152	hsa-miR-1277-5p	PAR-CLIP	23446348
MIRT509160	hsa-miR-369-3p	PAR-CLIP	23446348
MIRT509159	hsa-miR-5692b	PAR-CLIP	23446348
MIRT509158	hsa-miR-5692c	PAR-CLIP	23446348
MIRT509157	hsa-miR-410-3p	PAR-CLIP	23446348
MIRT509156	hsa-miR-5011-5p	PAR-CLIP	23446348
MIRT509155	hsa-miR-374a-5p	PAR-CLIP	23446348
MIRT509154	hsa-miR-374b-5p	PAR-CLIP	23446348
MIRT509153	hsa-miR-190a-3p	PAR-CLIP	23446348
MIRT509152	hsa-miR-1277-5p	PAR-CLIP	23446348
MIRT2105396	hsa-miR-583	CLIP-seq
MIRT2624172	hsa-miR-297	CLIP-seq
MIRT2624173	hsa-miR-3924	CLIP-seq
MIRT2624174	hsa-miR-567	CLIP-seq

Show/Hide all (2)

Transcription factor	Regulation	Reference
NFKB1	Activation	20385226
RELA	Activation	20385226

Show/Hide all (25)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005739	Component	Mitochondrion	HTP	34800366
GO:0005739	Component	Mitochondrion	IDA	10025957
GO:0005739	Component	Mitochondrion	IEA
GO:0005743	Component	Mitochondrial inner membrane	IEA
GO:0005743	Component	Mitochondrial inner membrane	TAS
GO:0008284	Process	Positive regulation of cell population proliferation	IEA
GO:0009409	Process	Response to cold	IBA
GO:0010917	Process	Negative regulation of mitochondrial membrane potential	IEA
GO:0015078	Function	Proton transmembrane transporter activity	IDA	22524567, 26182433
GO:0015108	Function	Chloride transmembrane transporter activity	IDA	22524567, 26182433
GO:0016020	Component	Membrane	IEA
GO:0022857	Function	Transmembrane transporter activity	IBA
GO:0031966	Component	Mitochondrial membrane	IDA	10025957
GO:0035356	Process	Intracellular triglyceride homeostasis	IEA
GO:0042803	Function	Protein homodimerization activity	IDA	26182433
GO:0043025	Component	Neuronal cell body	IEA
GO:0043066	Process	Negative regulation of apoptotic process	IEA
GO:0043524	Process	Negative regulation of neuron apoptotic process	IEA
GO:0045177	Component	Apical part of cell	IEA
GO:0046324	Process	Regulation of D-glucose import	IEA
GO:0048839	Process	Inner ear development	IEA
GO:0051562	Process	Negative regulation of mitochondrial calcium ion concentration	IEA
GO:0055085	Process	Transmembrane transport	IEA
GO:1902476	Process	Chloride transmembrane transport	IEA
GO:1902600	Process	Proton transmembrane transport	IEA

MIM	HGNC	e!Ensembl
613725	21065	ENSG00000153291

O95847

Protein name

Mitochondrial uncoupling protein 4 (UCP 4) (Solute carrier family 25 member 27)

Protein function

Facilitates proton transport across the inner mitochondrial membrane and may dissipate excessive proton gradient associated with oxidative and metabolic stress at neuronal synapses. Regulates glutamate-induced proton conductance in astrocytes, s

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00153	Mito_carr	16 → 120	Mitochondrial carrier protein	Family
PF00153	Mito_carr	123 → 222	Mitochondrial carrier protein	Family
PF00153	Mito_carr	225 → 320	Mitochondrial carrier protein	Family

Tissue specificity

TISSUE SPECIFICITY: Found in adult and fetal brain. Present in most of the brain tissues, with low levels in spinal cord, corpus callosum and substantia nigra. {ECO:0000269|PubMed:10025957}.

Sequence

MSVPEEEERLLPLTQRWPRASKFLLSGCAATVAELATFPLDLTKTRLQMQGEAALARLGD
GARESAPYRGMVRTALGIIEEEGFLKLWQGVTPAIYRHVVYSGGRMVTYEHLREVVFGKS
EDEHYPLWKSVIGGMMAGVIGQFLANPTDLVKVQMQMEGKRKLEGKPLRFRGVHHAFAKI
LAEGGIRGLWAGWVPNIQRAALVNMGDLTTYDTVKHYLVLNTPLEDNIMTHGLSSLCSGL
VASILGTPADVIKSRIMNQPRDKQGRGLLYKSSTDCLIQAVQGEGFMSLYKGFLPSWLRM
TPWSMVFWLTYEKIREMSGVSPF

Sequence length

323

Interactions

View interactions

	Reactome
			The fatty acid cycling model The proton buffering model

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (4)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
AUTOIMMUNE THYROID DISEASE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
GRAVES DISEASE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HASHIMOTO'S THYROIDITIS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SCHIZOPHRENIA	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (22)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Alzheimer Disease	Alzheimer disease	Pubtator	30425186	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Alzheimer Disease, Late Onset	Alzheimer disease	BEFREE	26923023, 30425186		★★★★★ ★☆☆☆☆ Found in Text Mining only
Autoimmune thyroiditis	Autoimmune Thyroiditis	GWASCAT_DG	25429627		★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	21621926		★★★★★ ★☆☆☆☆ Found in Text Mining only
Degenerative polyarthritis	Arthritis	BEFREE	26934480		★★★★★ ★☆☆☆☆ Found in Text Mining only
Frontotemporal dementia	Frontotemporal dementia	BEFREE	30425186		★★★★★ ★☆☆☆☆ Found in Text Mining only
Frontotemporal Dementia	Frontotemporal dementia	Pubtator	30425186	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Graves Disease	Graves Disease	GWASCAT_DG	25429627		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hashimoto Disease	Hashimoto Disease	GWASCAT_DG	25429627		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung neoplasms	Pubtator	36877954	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Mitochondrial complex I deficiency	Mitochondrial complex deficiency	Pubtator	22427795	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Multiple Sclerosis	Multiple Sclerosis	BEFREE	19536655		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	21621926		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	BEFREE	22427795		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	Pubtator	22427795	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Neurodegenerative Diseases	Neurodegenerative disorder	Pubtator	30425186	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Neurodegenerative Disorders	Neurodegenerative Disorders	BEFREE	26646004, 30425186		★★★★★ ★☆☆☆☆ Found in Text Mining only
Parkinson Disease	Parkinson disease	BEFREE	26646004, 29315581		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pick Disease of the Brain	Pica	BEFREE	30425186		★★★★★ ★☆☆☆☆ Found in Text Mining only
Schizophrenia	Schizophrenia	BEFREE	17066476, 21332312		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Schizophrenia	Schizophrenia	LHGDN	17066476		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Schizophrenia	Schizophrenia	PSYGENET_DG	17066476, 21332312		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

SLC25A27 (solute carrier family 25 member 27)