Gene Gene information from NCBI Gene database.
Entrez ID 9480
Gene name One cut homeobox 2
Gene symbol ONECUT2
Synonyms (NCBI Gene)
OC-2OC2
Chromosome 18
Chromosome location 18q21.31
Summary This gene encodes a member of the onecut family of transcription factors, which are characterized by a cut domain and an atypical homeodomain. The protein binds to specific DNA sequences and stimulates expression of target genes, including genes involved
miRNA miRNA information provided by mirtarbase database.
945
miRTarBase ID miRNA Experiments Reference
MIRT005390 hsa-miR-9-5p Luciferase reporter assayNorthern blotqRT-PCRWestern blot 16831872
MIRT005390 hsa-miR-9-5p Sequencing 20371350
MIRT031575 hsa-miR-16-5p Sequencing 20371350
MIRT032175 hsa-let-7d-5p Sequencing 20371350
MIRT437992 hsa-miR-429 Luciferase reporter assayWestern blotqRT-PCR 24402783
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
32
GO ID Ontology Definition Evidence Reference
GO:0000785 Component Chromatin ISA
GO:0000978 Function RNA polymerase II cis-regulatory region sequence-specific DNA binding IBA
GO:0000978 Function RNA polymerase II cis-regulatory region sequence-specific DNA binding IDA 11478782
GO:0000978 Function RNA polymerase II cis-regulatory region sequence-specific DNA binding IEA
GO:0000981 Function DNA-binding transcription factor activity, RNA polymerase II-specific IBA
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
MIM HGNC e!Ensembl
604894 8139 ENSG00000119547
Protein Protein information from UniProt database.
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
O95948
Protein name One cut domain family member 2 (Hepatocyte nuclear factor 6-beta) (HNF-6-beta) (One cut homeobox 2) (Transcription factor ONECUT-2) (OC-2)
Protein function Transcriptional activator. Activates the transcription of a number of liver genes such as HNF3B.
PDB 8T0F , 8T11
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF02376 CUT 329 407 CUT domain Domain
PF00046 Homeodomain 427 481 Homeodomain Domain
Sequence
MKAAYTAYRCLTKDLEGCAMNPELTMESLGTLHGPAGGGSGGGGGGGGGGGGGGPGHEQE
LLASPSPHHAGRGAAGSLRGPPPPPTAHQELGTAAAAAAAASRSAMVTSMASILDGGDYR
PELSIPLHHAMSMSCDSSPPGMGMSNTYTTLTPLQPLPPISTVSDKFHHPHPHHHPHHHH
HHHHQRLSGNVSGSFTLMRDERGLPAMNNLYSPYKEMPGMSQSLSPLAATPLGNGLGGLH
NAQQSLPNYGPPGHDKMLSPNFDAHHTAMLTRGEQHLSRGLGTPPAAMMSHLNGLHHPGH
TQSHGPVLAPSRERPPSSSSGSQVATSGQLEEINTKEVAQRITAELKRYSIPQAIFAQRV
LCRSQGTLSDLLRNPKPWSKLKSGRETFRRMWKWLQEPEFQRMSALR
LAACKRKEQEPNK
DRNNSQKKSRLVFTDLQRRTLFAIFKENKRPSKEMQITISQQLGLELTTVSNFFMNARRR
S
LEKWQDDLSTGGSSSTSSTCTKA
Sequence length 504
Interactions View interactions
Associated diseases Disease associations from ClinVar (causal & non-causal) and other databases (OMIM, Orphanet, GWAS, etc.).
6
Evidence Score: ★☆☆☆☆  Gene-disease association found in Text Mining only ★★☆☆☆  Found in Text Mining and Unknown/Other Associations ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
Phenotype Name Clinical Significance Source Evidence Score
Autosomal dominant polycystic kidney disease Uncertain significance ClinVar
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
Autosomal dominant polycystic liver disease Uncertain significance ClinVar
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
MIGRAINE DISORDER GWAS catalog
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
POLYCYSTIC KIDNEY, AUTOSOMAL DOMINANT Disgenet
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
Associations from Text Mining Disease associations identified through text mining
Disease Name Disease (Merged) Source PMID Relationship Type Evidence Score
Adenocarcinoma of prostate Prostate adenocarcinoma BEFREE 30655535
★☆☆☆☆
Found in Text Mining only
B-Cell Lymphomas B-Cell Lymphoma LHGDN 18288132
★☆☆☆☆
Found in Text Mining only
Brain Neoplasms Brain Neoplasms BEFREE 21745356
★☆☆☆☆
Found in Text Mining only
Carcinoma Hepatocellular Hepatocellular carcinoma Pubtator 26547929 Associate
★☆☆☆☆
Found in Text Mining only
Carcinoma Squamous Cell Squamous cell carcinoma Pubtator 22143938 Associate
★☆☆☆☆
Found in Text Mining only
Colorectal Carcinoma Colorectal Cancer BEFREE 30323194
★☆☆☆☆
Found in Text Mining only
Colorectal Neoplasms Colorectal neoplasm Pubtator 24402783, 32377269 Associate
★☆☆☆☆
Found in Text Mining only
Coronary Artery Disease Coronary artery disease Pubtator 32971215 Associate
★☆☆☆☆
Found in Text Mining only
Lung Neoplasms Lung neoplasms Pubtator 31882655 Associate
★☆☆☆☆
Found in Text Mining only
Malignant neoplasm of prostate Prostate cancer BEFREE 25788493, 30478421, 30655535
★☆☆☆☆
Found in Text Mining only