Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	9470
Gene name	Eukaryotic translation initiation factor 4E family member 2
Gene symbol	EIF4E2
Synonyms (NCBI Gene)	4E-LP4EHPEIF4EL3IF4eh4EHP
Chromosome	2
Chromosome location	2q37.1

Show/Hide all (23)

miRTarBase ID	miRNA	Experiments	Reference
MIRT020573	hsa-miR-155-5p	Proteomics	18668040
MIRT027566	hsa-miR-98-5p	Microarray	19088304
MIRT047290	hsa-miR-181b-5p	CLASH	23622248
MIRT727790	hsa-miR-19a-3p	HITS-CLIP	22473208
MIRT727789	hsa-miR-19b-3p	HITS-CLIP	22473208
MIRT958106	hsa-miR-1207-3p	CLIP-seq
MIRT958107	hsa-miR-1236	CLIP-seq
MIRT958108	hsa-miR-1245	CLIP-seq
MIRT958109	hsa-miR-29a	CLIP-seq
MIRT958110	hsa-miR-29b	CLIP-seq
MIRT958111	hsa-miR-29c	CLIP-seq
MIRT958112	hsa-miR-3163	CLIP-seq
MIRT958113	hsa-miR-3662	CLIP-seq
MIRT958114	hsa-miR-4477a	CLIP-seq
MIRT958115	hsa-miR-4695-3p	CLIP-seq
MIRT958116	hsa-miR-4729	CLIP-seq
MIRT958117	hsa-miR-767-5p	CLIP-seq
MIRT2522323	hsa-miR-4419a	CLIP-seq
MIRT2522324	hsa-miR-4510	CLIP-seq
MIRT2522325	hsa-miR-520a-5p	CLIP-seq
MIRT2522326	hsa-miR-525-5p	CLIP-seq
MIRT2522325	hsa-miR-520a-5p	CLIP-seq
MIRT2522326	hsa-miR-525-5p	CLIP-seq

Show/Hide all (28)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000339	Function	RNA cap binding	TAS	9582349
GO:0000340	Function	RNA 7-methylguanosine cap binding	IBA
GO:0000340	Function	RNA 7-methylguanosine cap binding	IDA	35878012
GO:0000932	Component	P-body	IDA	23991149
GO:0000932	Component	P-body	IEA
GO:0003723	Function	RNA binding	HDA	22681889
GO:0003723	Function	RNA binding	IEA
GO:0003743	Function	Translation initiation factor activity	IBA
GO:0003743	Function	Translation initiation factor activity	IEA
GO:0005515	Function	Protein binding	IPI	15094042, 15161933, 16189514, 17368478, 19060904, 22678294, 23991149, 25416956, 25959826, 28487484, 28514442, 28698298, 31439631, 31515488, 32814053, 33053355, 33961781, 35271311
GO:0005737	Component	Cytoplasm	IDA	23991149
GO:0005737	Component	Cytoplasm	IEA
GO:0005829	Component	Cytosol	TAS
GO:0006412	Process	Translation	IEA
GO:0006413	Process	Translational initiation	IBA
GO:0006413	Process	Translational initiation	IEA
GO:0006417	Process	Regulation of translation	IEA
GO:0008135	Function	Translation factor activity, RNA binding	TAS	9582349
GO:0016281	Component	Eukaryotic translation initiation factor 4F complex	IBA
GO:0017148	Process	Negative regulation of translation	IMP	22751931
GO:0031047	Process	Regulatory ncRNA-mediated gene silencing	IEA
GO:0031625	Function	Ubiquitin protein ligase binding	IPI	14623119
GO:0035278	Process	MiRNA-mediated gene silencing by inhibition of translation	IDA	28487484
GO:0045947	Process	Negative regulation of translational initiation	IDA	32726578, 35878012
GO:0060337	Process	Type I interferon-mediated signaling pathway	IDA	33581076
GO:0060339	Process	Negative regulation of type I interferon-mediated signaling pathway	IDA	35878012
GO:0072344	Process	Rescue of stalled ribosome	IDA	32726578
GO:0098808	Function	MRNA cap binding	IDA	17368478

MIM	HGNC	e!Ensembl
605895	3293	ENSG00000135930

O60573

Protein name

Eukaryotic translation initiation factor 4E type 2 (eIF-4E type 2) (eIF4E type 2) (Eukaryotic translation initiation factor 4E homologous protein) (Eukaryotic translation initiation factor 4E-like 3) (eIF4E-like protein 4E-LP) (mRNA cap-binding protein 4E

Protein function

Recognizes and binds the 7-methylguanosine-containing mRNA cap during an early step in the initiation. Acts as a repressor of translation initiation (PubMed:17368478, PubMed:22751931, PubMed:25624349, PubMed:33581076, PubMed:9582349). In contras

PDB

2JGB , 2JGC , 5NVK , 5NVL , 5NVM , 5NVN , 5XLN

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF01652	IF4E	55 → 214	Eukaryotic initiation factor 4E	Domain

Sequence

MNNKFDALKDDDSGDHDQNEENSTQKDGEKEKTERDKNQSSSKRKAVVPGPAEHPLQYNY
TFWYSRRTPGRPTSSQSYEQNIKQIGTFASVEQFWRFYSHMVRPGDLTGHSDFHLFKEGI
KPMWEDDANKNGGKWIIRLRKGLASRCWENLILAMLGEQFMVGEEICGAVVSVRFQEDII
SIWNKTASDQATTARIRDTLRRVLNLPPNTIMEYKTHTDSIKMPGRLGPQRLLFQNLWKP
RLNVP

Sequence length

245

Interactions

View interactions

	KEGG		Reactome
	EGFR tyrosine kinase inhibitor resistance HIF-1 signaling pathway mTOR signaling pathway PI3K-Akt signaling pathway Longevity regulating pathway Insulin signaling pathway		ISG15 antiviral mechanism

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (1)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
NON-SMALL CELL LUNG CARCINOMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (11)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Breast Carcinoma	Breast Carcinoma	BEFREE	28991229		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	BEFREE	28991229		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma Multiforme	Glioblastoma	BEFREE	28991229		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypoxia	Hypoxia	Pubtator	23667251	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypoxia	Hypoxia	Pubtator	27002144, 28991229	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia Myeloid Acute	Myeloid leukemia	Pubtator	39611741	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	24408918, 28991229		★★★★★ ★☆☆☆☆ Found in Text Mining only
Myocardial Ischemia	Myocardial ischemia	Pubtator	27002144	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	24408918, 29317983		★★★★★ ★☆☆☆☆ Found in Text Mining only
Non-Small Cell Lung Carcinoma	Lung carcinoma	GWASCAT_DG	21079520		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Triple Negative Breast Neoplasms	Triple negative breast cancer	Pubtator	34791795	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only

EIF4E2 (eukaryotic translation initiation factor 4E family member 2)