CD34 (CD34 molecule)

Gene

• Entrez ID: 947
• Gene name: CD34 molecule
• Gene symbol: CD34
• Synonyms (NCBI Gene): -
• Chromosome: 1
• Chromosome location: 1q32.2
• Summary: The protein encoded by this gene may play a role in the attachment of stem cells to the bone marrow extracellular matrix or to stromal cells. This single-pass membrane protein is highly glycosylated and phosphorylated by protein kinase C. Two transcript v

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT004052	hsa-miR-125a-5p	Luciferase reporter assay, Microarray, Western blot	18308931
MIRT020428	hsa-miR-106b-5p	Microarray	17242205
MIRT004052	hsa-miR-125a-5p	Reporter assay;Western blot	18308931
MIRT021486	hsa-miR-9-5p	Western blot	18308931
MIRT030549	hsa-miR-24-3p	qRT-PCR	19748357
MIRT875110	hsa-miR-143	CLIP-seq
MIRT875111	hsa-miR-185	CLIP-seq
MIRT875112	hsa-miR-3126-5p	CLIP-seq
MIRT875113	hsa-miR-3150b-3p	CLIP-seq
MIRT875114	hsa-miR-4306	CLIP-seq
MIRT875115	hsa-miR-431	CLIP-seq
MIRT875116	hsa-miR-432	CLIP-seq
MIRT875117	hsa-miR-4419a	CLIP-seq
MIRT875118	hsa-miR-4433	CLIP-seq
MIRT875119	hsa-miR-4443	CLIP-seq
MIRT875120	hsa-miR-4510	CLIP-seq
MIRT875121	hsa-miR-4644	CLIP-seq
MIRT875122	hsa-miR-4711-3p	CLIP-seq
MIRT875123	hsa-miR-4770	CLIP-seq
MIRT875124	hsa-miR-4784	CLIP-seq
MIRT875125	hsa-miR-4785	CLIP-seq
MIRT875126	hsa-miR-665	CLIP-seq
MIRT875127	hsa-miR-765	CLIP-seq
MIRT875128	hsa-miR-1207-5p	CLIP-seq
MIRT875129	hsa-miR-1301	CLIP-seq
MIRT875130	hsa-miR-1321	CLIP-seq
MIRT875131	hsa-miR-1343	CLIP-seq
MIRT875132	hsa-miR-149	CLIP-seq
MIRT875133	hsa-miR-1909	CLIP-seq
MIRT875134	hsa-miR-2276	CLIP-seq
MIRT875135	hsa-miR-3064-5p	CLIP-seq
MIRT875136	hsa-miR-3154	CLIP-seq
MIRT875137	hsa-miR-3922-5p	CLIP-seq
MIRT875138	hsa-miR-3944-5p	CLIP-seq
MIRT875139	hsa-miR-4270	CLIP-seq
MIRT875140	hsa-miR-4326	CLIP-seq
MIRT875117	hsa-miR-4419a	CLIP-seq
MIRT875141	hsa-miR-4434	CLIP-seq
MIRT875142	hsa-miR-4441	CLIP-seq
MIRT875143	hsa-miR-4445	CLIP-seq
MIRT875144	hsa-miR-4447	CLIP-seq
MIRT875145	hsa-miR-4472	CLIP-seq
MIRT875146	hsa-miR-4488	CLIP-seq
MIRT875120	hsa-miR-4510	CLIP-seq
MIRT875147	hsa-miR-4516	CLIP-seq
MIRT875148	hsa-miR-4529-5p	CLIP-seq
MIRT875149	hsa-miR-4537	CLIP-seq
MIRT875150	hsa-miR-4651	CLIP-seq
MIRT875151	hsa-miR-4660	CLIP-seq
MIRT875152	hsa-miR-4685-5p	CLIP-seq
MIRT875153	hsa-miR-4697-5p	CLIP-seq
MIRT875154	hsa-miR-4708-3p	CLIP-seq
MIRT875155	hsa-miR-4728-5p	CLIP-seq
MIRT875156	hsa-miR-4739	CLIP-seq
MIRT875157	hsa-miR-4753-5p	CLIP-seq
MIRT875158	hsa-miR-4756-5p	CLIP-seq
MIRT875159	hsa-miR-4763-3p	CLIP-seq
MIRT875160	hsa-miR-4794	CLIP-seq
MIRT875161	hsa-miR-4795-5p	CLIP-seq
MIRT875162	hsa-miR-486-3p	CLIP-seq
MIRT875163	hsa-miR-5047	CLIP-seq
MIRT875164	hsa-miR-608	CLIP-seq
MIRT1546262	hsa-miR-3529	CLIP-seq
MIRT1546263	hsa-miR-3670	CLIP-seq
MIRT1546264	hsa-miR-379	CLIP-seq
MIRT1546265	hsa-miR-4451	CLIP-seq
MIRT1546266	hsa-miR-4633-3p	CLIP-seq
MIRT1546267	hsa-miR-4650-3p	CLIP-seq
MIRT1546268	hsa-miR-4717-3p	CLIP-seq
MIRT1546269	hsa-miR-4802-3p	CLIP-seq
MIRT1959472	hsa-miR-4723-5p	CLIP-seq
MIRT2196456	hsa-miR-513a-3p	CLIP-seq
MIRT2446580	hsa-miR-1286	CLIP-seq
MIRT875138	hsa-miR-3944-5p	CLIP-seq
MIRT2446581	hsa-miR-4522	CLIP-seq
MIRT2446582	hsa-miR-4722-5p	CLIP-seq
MIRT2446583	hsa-miR-548a-3p	CLIP-seq
MIRT2446584	hsa-miR-548e	CLIP-seq
MIRT2446585	hsa-miR-548f	CLIP-seq
MIRT2446586	hsa-miR-548g	CLIP-seq

Transcription factors

Transcription factor	Regulation	Reference
MYB	Unknown	7523384
MZF1	Unknown	8585946
RUNX1	Activation	21873977
TAL1	Repression	14715640

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001894	Process	Tissue homeostasis	IDA	12939361
GO:0001935	Process	Endothelial cell proliferation	IDA	21835908
GO:0003094	Process	Glomerular filtration	IEP	20354148
GO:0003158	Process	Endothelium development	IEP	17261663
GO:0005515	Function	Protein binding	IPI	32296183
GO:0005576	Component	Extracellular region	IEA
GO:0005737	Component	Cytoplasm	IDA	7525669
GO:0005737	Component	Cytoplasm	IEA
GO:0005764	Component	Lysosome	ISS
GO:0005886	Component	Plasma membrane	IDA	1868864, 7525669, 9042286, 17464107
GO:0005886	Component	Plasma membrane	IEA
GO:0005886	Component	Plasma membrane	TAS	9042286
GO:0007155	Process	Cell adhesion	IEA
GO:0007160	Process	Cell-matrix adhesion	IBA
GO:0007165	Process	Signal transduction	IEP	17261663
GO:0009897	Component	External side of plasma membrane	IC	15249540
GO:0009897	Component	External side of plasma membrane	IDA	10337918, 12939361, 20354148
GO:0009897	Component	External side of plasma membrane	IEA
GO:0009925	Component	Basal plasma membrane	ISS
GO:0009986	Component	Cell surface	IEA
GO:0010628	Process	Positive regulation of gene expression	IEP	17261663
GO:0010629	Process	Negative regulation of gene expression	IMP	15969628
GO:0016020	Component	Membrane	IEA
GO:0016324	Component	Apical plasma membrane	ISS
GO:0030097	Process	Hemopoiesis	IMP	15969628
GO:0030246	Function	Carbohydrate binding	IDA	15249540
GO:0032703	Process	Negative regulation of interleukin-2 production	IMP	9815891
GO:0035759	Process	Mesangial cell-matrix adhesion	ISS
GO:0036053	Component	Glomerular endothelium fenestra	ISS
GO:0038001	Process	Paracrine signaling	IDA	21835908
GO:0042482	Process	Positive regulation of odontogenesis	IDA	12939361
GO:0043199	Function	Sulfate binding	IEA
GO:0045171	Component	Intercellular bridge	IDA	7525669
GO:0045766	Process	Positive regulation of angiogenesis	IDA	12939361, 21835908
GO:0048471	Component	Perinuclear region of cytoplasm	IDA	7525669
GO:0048870	Process	Cell motility	IEP	17261663
GO:0050900	Process	Leukocyte migration	IEA
GO:0050900	Process	Leukocyte migration	ISS
GO:0060290	Process	Transdifferentiation	IEP	1868864
GO:0061042	Process	Vascular wound healing	IEP	20354148
GO:0061629	Function	RNA polymerase II-specific DNA-binding transcription factor binding	IPI	21873977
GO:0071425	Process	Hematopoietic stem cell proliferation	IMP	21873977
GO:0071657	Process	Positive regulation of granulocyte colony-stimulating factor production	IDA	9815891
GO:0071657	Process	Positive regulation of granulocyte colony-stimulating factor production	IEP	17261663
GO:0071944	Component	Cell periphery	IEA
GO:0071971	Process	Extracellular exosome assembly	IDA	21835908
GO:0072011	Process	Glomerular endothelium development	IEP	17464107
GO:0072089	Process	Stem cell proliferation	IEP	17261663
GO:0072254	Process	Metanephric glomerular mesangial cell differentiation	IEP	1868864
GO:0098609	Process	Cell-cell adhesion	IDA	15249540
GO:2001214	Process	Positive regulation of vasculogenesis	IDA	12939361

Other IDs

• MIM: 142230
• HGNC: 1662
• e!Ensembl: ENSG00000174059

Protein

• UniProt ID: P28906
• Protein name: Hematopoietic progenitor cell antigen CD34 (CD antigen CD34)
• Protein function: Possible adhesion molecule with a role in early hematopoiesis by mediating the attachment of stem cells to the bone marrow extracellular matrix or directly to stromal cells. Could act as a scaffold for the attachment of lineage specific glycans,
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF06365	CD34_antigen	190 → 385	CD34/Podocalyxin family	Family

• Tissue specificity: TISSUE SPECIFICITY: Selectively expressed on hematopoietic progenitor cells and the small vessel endothelium of a variety of tissues.
• Sequence:

  MLVRRGARAGPRMPRGWTALCLLSLLPSGFMSLDNNGTATPELPTQGTFSNVSTNVSYQE
  TTTPSTLGSTSLHPVSQHGNEATTNITETTVKFTSTSVITSVYGNTNSSVQSQTSVISTV
  FTTPANVSTPETTLKPSLSPGNVSDLSTTSTSLATSPTKPYTSSSPILSDIKAEIKCSGI
  REVKLTQGICLEQNKTSSCAEFKKDRGEGLARVLCGEEQADADAGAQVCSLLLAQSEVRP
  QCLLLVLANRTEISSKLQLMKKHQSDLKKLGILDFTEQDVASHQSYSQKTLIALVTSGAL
  LAVLGITGYFLMNRRSWSPTGERLGEDPYYTENGGGQGYSSGPGTSPEAQGKASVNRGAQ
  ENGTGQATSRNGHSARQHVVADTEL

• Sequence length: 385

Pathways

KEGG:

Cell adhesion molecules
Hematopoietic cell lineage

Reactome:

Immunoregulatory interactions between a Lymphoid and a non-Lymphoid cell

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
ALZHEIMER DISEASE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BREAST CANCER	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BREAST CARCINOMA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CARCINOMA, HEPATOCELLULAR	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MAJOR DEPRESSIVE DISORDER	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
NONORGANIC PSYCHOSIS	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PSYCHOTIC DISORDERS	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
UNIPOLAR DEPRESSION	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
5q-syndrome	5q-syndrome	BEFREE	18477045		★☆☆☆☆ Found in Text Mining only
Abetalipoproteinemia	Abetalipoproteinemia	BEFREE	12855552		★☆☆☆☆ Found in Text Mining only
Acute Coronary Syndrome	Coronary Syndrome	BEFREE	28060837		★☆☆☆☆ Found in Text Mining only
Acute Erythroblastic Leukemia	Erythroblastic Leukemia	BEFREE	23180570		★☆☆☆☆ Found in Text Mining only
Acute leukemia	Leukemia	BEFREE	12853345, 12953810, 15471948, 1705862, 18702870, 18803279, 20376583, 2459568, 27595757, 7540889, 8528052		★☆☆☆☆ Found in Text Mining only
Acute lymphocytic leukemia	Lymphocytic Leukemia	BEFREE	10477734, 11531016, 1548523, 15548716, 15580304, 16029452, 16643437, 1696310, 16979235, 17041637, 1713508, 17646667, 17717597, 18683236, 19762535, 20498303, 21792039, 22898323, 24400095, 25538041, 28691152, 28730166, 29772458, 30059823, 7532767, 7536510, 8353275, 8946942, 9107079, 9114595, 9305606		★☆☆☆☆ Found in Text Mining only
Acute monocytic leukemia	Monocytic Leukemia	BEFREE	10721774, 11168757, 12008077, 20232575, 20505189, 21135860, 21739277, 21760593, 22258035, 22289983, 22898323, 23604035, 25990244, 27065320, 30352278, 30848055, 7528566		★☆☆☆☆ Found in Text Mining only
Acute Myeloid Leukemia, M1	Myeloid Leukemia	BEFREE	2646903		★☆☆☆☆ Found in Text Mining only
Acute myeloid leukemia, minimal differentiation	Myeloid Leukemia	BEFREE	22162288, 9002966		★☆☆☆☆ Found in Text Mining only
Acute myelomonocytic leukemia	Myelomonocytic Leukemia	BEFREE	25241285		★☆☆☆☆ Found in Text Mining only
Acute pancreatitis	Pancreatitis	BEFREE	29971769, 31688596		★☆☆☆☆ Found in Text Mining only
Acute Promyelocytic Leukemia	Promyelocytic Leukemia	BEFREE	10587705, 11721970, 11734301, 12827650, 15108165, 16531253, 17259349, 19291801, 19749800, 19797526, 20232575, 21812014, 25369030, 28002788, 28984423, 29274134, 30002801, 7516029, 7528566, 9279368		★☆☆☆☆ Found in Text Mining only
Acute Promyelocytic Leukemia	Promyelocytic Leukemia	LHGDN	12827650, 17449014		★☆☆☆☆ Found in Text Mining only
Acute Undifferentiated Leukemia	Leukemia	BEFREE	1376964, 14513050, 21734239, 27611922, 31002948, 7688180, 7795240		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma	Adenocarcinoma	LHGDN	12883699		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma	Adenocarcinoma	BEFREE	31760702		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of lung (disorder)	Lung adenocarcinoma	BEFREE	25359683, 31798347		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of prostate	Prostate adenocarcinoma	BEFREE	28552539		★☆☆☆☆ Found in Text Mining only
Adenoma	Adenoma	BEFREE	19350238, 9918211		★☆☆☆☆ Found in Text Mining only
Adenosine deaminase deficiency	Adenosine Deaminase Deficiency	BEFREE	7691188, 8867866		★☆☆☆☆ Found in Text Mining only
Adrenoleukodystrophy	Adrenoleukodystrophy	BEFREE	12668127, 25079382		★☆☆☆☆ Found in Text Mining only
Adult Acute Lymphocytic Leukemia	Lymphocytic Leukemia	BEFREE	10477734, 10733508, 11531016, 1548523, 1696310, 16979235, 17170128, 21792039, 22898323, 24400095, 28730166, 29772458, 7532767, 8946942		★☆☆☆☆ Found in Text Mining only
Adult Acute Myeloblastic Leukemia	Myeloblastic Leukemia	BEFREE	16079892, 24574459		★☆☆☆☆ Found in Text Mining only
Adult Hodgkin Lymphoma	Hodgkin Lymphoma	BEFREE	20100355, 30549248		★☆☆☆☆ Found in Text Mining only
Adult Oligodendroglioma	Oligodendroglioma	BEFREE	27812792		★☆☆☆☆ Found in Text Mining only
Adult T-Cell Lymphoma/Leukemia	T-Cell Lymphoma/Leukemia	BEFREE	10455355, 18818438		★☆☆☆☆ Found in Text Mining only
Adult type dermatomyositis	Dermatomyositis	BEFREE	30038095		★☆☆☆☆ Found in Text Mining only
Age related macular degeneration	Age-related macular degeneration	BEFREE	28777387		★☆☆☆☆ Found in Text Mining only
Albinism with hemorrhagic diathesis and pigmented reticuloendothelial cells	Albinism With Hemorrhagic Diathesis And Pigmented Reticuloendothelial Cells	BEFREE	27459687		★☆☆☆☆ Found in Text Mining only
Alexander Disease	Alexander disease	Pubtator	31263845	Associate	★☆☆☆☆ Found in Text Mining only
Alopecia, Male Pattern	Alopecia, Male Pattern	BEFREE	21206086, 31478937		★☆☆☆☆ Found in Text Mining only
alpha-Thalassemia	alpha Thalassemia	BEFREE	28871148		★☆☆☆☆ Found in Text Mining only
ALPHA-THALASSEMIA/MENTAL RETARDATION SYNDROME, NONDELETION TYPE, X-LINKED	alpha-Thalassemia Mental Retardation Syndrome, X-Linked	BEFREE	30051533		★☆☆☆☆ Found in Text Mining only
alpha^+^ Thalassemia	alpha Thalassemia	BEFREE	28871148		★☆☆☆☆ Found in Text Mining only
Alveolar capillary dysplasia	Alveolar capillary dysplasia	Pubtator	30739309, 32600276	Associate	★☆☆☆☆ Found in Text Mining only
Alveolar rhabdomyosarcoma	Alveolar Rhabdomyosarcoma	BEFREE	26970672		★☆☆☆☆ Found in Text Mining only
Alveolar Soft Part Sarcoma	Alveolar Sarcoma	BEFREE	19636271		★☆☆☆☆ Found in Text Mining only
Ameloblastoma	Ameloblastoma	BEFREE	11896820, 27859616, 29559247		★☆☆☆☆ Found in Text Mining only
Ameloblastoma	Ameloblastoma	Pubtator	24223460, 24810924	Associate	★☆☆☆☆ Found in Text Mining only
Amyotrophic Lateral Sclerosis	Amyotrophic Lateral Sclerosis	BEFREE	31395804		★☆☆☆☆ Found in Text Mining only
Anaplasia	Anaplasia	BEFREE	30173272, 31760702		★☆☆☆☆ Found in Text Mining only
Androgenetic Alopecia	Androgenetic Alopecia	BEFREE	21206086, 31478937		★☆☆☆☆ Found in Text Mining only
Anemia	Anemia	BEFREE	31276271, 8030658		★☆☆☆☆ Found in Text Mining only
Anemia Aplastic	Aplastic anemia	Pubtator	10759717, 11167757, 11328281, 11380462, 12404285, 12846899, 14504100, 15246163, 15345281, 16131564, 22315490, 23028422, 24727813, 25368817, 8701944	Associate	★☆☆☆☆ Found in Text Mining only
Anemia Aplastic	Aplastic anemia	Pubtator	25359990	Inhibit	★☆☆☆☆ Found in Text Mining only
Anemia Refractory	Refractory anemia	Pubtator	10706070, 12404285, 16527891, 19692701, 20633296, 27663637	Associate	★☆☆☆☆ Found in Text Mining only
Anemia Sickle Cell	Sickle cell anemia	Pubtator	15145217, 18064299, 25681747, 27406980, 30972754, 33956057, 33958780, 36560719, 36569951	Associate	★☆☆☆☆ Found in Text Mining only
Anemia, Diamond-Blackfan	Anemia	BEFREE	12351378, 12718904, 15626736, 15755903, 18217898, 18715690, 21527522		★☆☆☆☆ Found in Text Mining only
Anemia, Sickle Cell	Anemia	BEFREE	12032689, 15145214, 16378095, 22479321, 25733580, 27406980, 29931411, 30972754, 31178391, 31698466		★☆☆☆☆ Found in Text Mining only
Angiokeratoma	Angiokeratoma	Pubtator	31169171	Associate	★☆☆☆☆ Found in Text Mining only
ANOPHTHALMIA AND PULMONARY HYPOPLASIA	Syndromic microphthalmia	BEFREE	30899402		★☆☆☆☆ Found in Text Mining only
Anxiety	Anxiety Disorder	BEFREE	29439917		★☆☆☆☆ Found in Text Mining only
Anxiety Disorders	Anxiety Disorder	BEFREE	29439917		★☆☆☆☆ Found in Text Mining only
Aortic Aneurysm	Aortic aneurysm	Pubtator	23411750	Associate	★☆☆☆☆ Found in Text Mining only
Aortic Aneurysm Abdominal	Aortic aneurysm	Pubtator	24997808	Associate	★☆☆☆☆ Found in Text Mining only
Aortic Valve Calcification of	Aortic valve disease	Pubtator	39313278	Inhibit	★☆☆☆☆ Found in Text Mining only
Aortic Valve Stenosis	Aortic valve stenosis	Pubtator	39313278	Associate	★☆☆☆☆ Found in Text Mining only
Aplastic Anemia	Aplastic anemia	BEFREE	11328281, 16960339, 18043245, 18637807, 19772889, 22315490, 23028422, 25359990, 8701944		★☆☆☆☆ Found in Text Mining only
Apraxia, Developmental Verbal	Apraxia	BEFREE	29771429		★☆☆☆☆ Found in Text Mining only
Arteriosclerosis	Arteriosclerosis	BEFREE	19758589, 20489139, 28282559, 28301500, 30669689, 30818167, 31785607		★☆☆☆☆ Found in Text Mining only
Arthritis Juvenile	Juvenile arthritis	Pubtator	20576155	Stimulate	★☆☆☆☆ Found in Text Mining only
Arthritis Psoriatic	Psoriatic arthritis	Pubtator	35168627	Associate	★☆☆☆☆ Found in Text Mining only
Arthritis Rheumatoid	Rheumatoid arthritis	Pubtator	15593185, 16519794, 18383391, 35168627, 37934808, 9858207	Associate	★☆☆☆☆ Found in Text Mining only
Arthritis Rheumatoid	Rheumatoid arthritis	Pubtator	9886323	Stimulate	★☆☆☆☆ Found in Text Mining only
Asthma	Asthma	BEFREE	11306982, 11724761, 17581195, 28850257, 9870912, 9893192		★☆☆☆☆ Found in Text Mining only
Asthma	Asthma	Pubtator	11724761, 22990537	Associate	★☆☆☆☆ Found in Text Mining only
Astrocytoma	Astrocytoma	Pubtator	23442159, 24345274, 31346129	Associate	★☆☆☆☆ Found in Text Mining only
Astrocytoma	Astrocytoma	BEFREE	31004262		★☆☆☆☆ Found in Text Mining only
Atherosclerosis	Atherosclerosis	Pubtator	18578002, 22855739, 23991206, 27938493	Associate	★☆☆☆☆ Found in Text Mining only
Atherosclerosis	Atherosclerosis	BEFREE	19758589, 20489139, 28282559, 28301500, 30669689, 30818167, 31785607		★☆☆☆☆ Found in Text Mining only
Atrophy	Atrophy	Pubtator	29040640	Associate	★☆☆☆☆ Found in Text Mining only
Autoimmune Diseases	Autoimmune Diseases	BEFREE	26143958, 29367719, 29980767		★☆☆☆☆ Found in Text Mining only
B Acute Lymphoblastic Leukemia with t(9;22)(q34.1;q11.2); BCR-ABL1	Lymphoblastic Leukemia	BEFREE	14686492, 1705862, 18704194, 22323189, 26607903		★☆☆☆☆ Found in Text Mining only
B-Cell Lymphomas	B-Cell Lymphoma	BEFREE	23287123		★☆☆☆☆ Found in Text Mining only
B-CELL MALIGNANCY, LOW-GRADE	Lymphocytic Leukemia	BEFREE	10554806, 9192749, 9209642		★☆☆☆☆ Found in Text Mining only
Benign Prostatic Hyperplasia	Benign Prostatic Hyperplasia	BEFREE	27732940, 28181681, 28730786		★☆☆☆☆ Found in Text Mining only
beta Thalassemia	beta Thalassemia	BEFREE	11146156, 20008255, 21875313, 22479321		★☆☆☆☆ Found in Text Mining only
beta Thalassemia	Beta thalassemia	Pubtator	11146156, 21156846, 21750082, 23861885, 27987208, 30079761, 30704988, 32912325, 34980909, 36639729	Associate	★☆☆☆☆ Found in Text Mining only
beta^+^ Thalassemia	beta Thalassemia	BEFREE	20008255, 21875313, 22479321		★☆☆☆☆ Found in Text Mining only
Biliary Atresia	Biliary atresia	Pubtator	24696612	Associate	★☆☆☆☆ Found in Text Mining only
Bladder Neoplasm	Bladder Neoplasm	BEFREE	29556633		★☆☆☆☆ Found in Text Mining only
Blast Crisis	Blast crisis	Pubtator	22033489	Associate	★☆☆☆☆ Found in Text Mining only
Blast Phase	Blast phase chronic myelogenous leukemia	BEFREE	10500825, 11264175, 11861294, 12446442, 15153610, 15805265, 15858613, 16204063, 16442619, 17284533, 17925491, 18268096, 18550858, 19723894, 21132730, 21527515, 24098519, 26966074, 29549929, 30301525, 31615652, 7795240		★☆☆☆☆ Found in Text Mining only
Blood Coagulation Disorders	Blood Coagulation Disorders	BEFREE	28238096		★☆☆☆☆ Found in Text Mining only
Blood Platelet Disorders	Platelet disorder	Pubtator	10449749, 10845892	Associate	★☆☆☆☆ Found in Text Mining only
Blood Platelet Disorders	Platelet-type bleeding disorder	BEFREE	10845892, 22271903		★☆☆☆☆ Found in Text Mining only
Bone Marrow Diseases	Bone marrow diseases	Pubtator	12199781, 27077772	Associate	★☆☆☆☆ Found in Text Mining only
Bone Marrow Diseases	Bone marrow diseases	Pubtator	31042345	Stimulate	★☆☆☆☆ Found in Text Mining only
Bone Marrow Failure Disorders	Bone marrow failure syndromes	Pubtator	29976742	Associate	★☆☆☆☆ Found in Text Mining only
Brain Ischemia	Brain ischemia	Pubtator	31018749	Associate	★☆☆☆☆ Found in Text Mining only
Brain Neoplasms	Brain neoplasms	Pubtator	32795351	Associate	★☆☆☆☆ Found in Text Mining only
Brain Neoplasms	Brain Neoplasms	BEFREE	8290310		★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	10389945, 10811478, 12208755, 18165897, 23053664, 25652007, 26294068, 26470709, 29275302, 29745079, 30229826, 30320661, 8978310		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Breast Carcinoma	Breast Carcinoma	GWASCAT_DG	29059683		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Breast Diseases	Breast Diseases	BEFREE	27881867		★☆☆☆☆ Found in Text Mining only
Breast Diseases	Breast disease	Pubtator	27881867	Associate	★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	11049977, 16110287, 16286998, 21737256, 21826535, 22207429, 23469238, 25339428, 25803686, 29745079, 36055119, 39270542, 9885238	Associate	★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	15627894, 25011545	Inhibit	★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	30229826	Stimulate	★☆☆☆☆ Found in Text Mining only
Bronchopulmonary Dysplasia	Bronchopulmonary Dysplasia	BEFREE	31799226		★☆☆☆☆ Found in Text Mining only
Burkitt Leukemia	Burkitt`s Lymphoma	BEFREE	29187045		★☆☆☆☆ Found in Text Mining only
Burkitt Lymphoma	Burkitt lymphoma	Pubtator	35077634	Associate	★☆☆☆☆ Found in Text Mining only
Calcinosis	Calcinosis	Pubtator	29745079, 39313278	Associate	★☆☆☆☆ Found in Text Mining only
Carcinogenesis	Carcinogenesis	Pubtator	15315976, 24507660, 39506790	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma	Carcinoma	BEFREE	15483023, 15929172, 17310847, 25519836, 30529837, 9422527, 9918211		★☆☆☆☆ Found in Text Mining only
Carcinoma	Carcinoma	Pubtator	20228779, 31027104, 32669612, 34326362, 35900506, 36229858, 36357104	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma	Carcinoma	Pubtator	24022313, 29085834, 32175898, 32972278	Stimulate	★☆☆☆☆ Found in Text Mining only
Carcinoma Basal Cell	Basal cell carcinoma	Pubtator	21338206	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Ductal	Ductal carcinoma	Pubtator	15627894, 25011545	Inhibit	★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	16650286, 16775432, 17786144, 18602664, 21480209, 23940715, 24507660, 25749520, 26797961, 26934653, 30092792, 30178842, 35637248	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma in Situ	Carcinoma in situ	Pubtator	23469238	Inhibit	★☆☆☆☆ Found in Text Mining only
Carcinoma Intraductal Noninfiltrating	Intraductal noninfiltrating carcinoma	Pubtator	11953822, 16286998, 18384688, 23469238	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Intraductal Noninfiltrating	Intraductal noninfiltrating carcinoma	Pubtator	12663638	Inhibit	★☆☆☆☆ Found in Text Mining only
Carcinoma Lobular	Lobular carcinoma	Pubtator	36055119	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma of lung	Lung carcinoma	BEFREE	10373662, 21660060, 28004467, 28339070		★☆☆☆☆ Found in Text Mining only
Carcinoma Renal Cell	Renal cell carcinoma	Pubtator	22042086, 24086736, 27031776, 28287633	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Renal Cell	Renal cell carcinoma	Pubtator	38031731	Stimulate	★☆☆☆☆ Found in Text Mining only
Carcinoma Renal Cell	Renal cell carcinoma	Pubtator	9845545	Inhibit	★☆☆☆☆ Found in Text Mining only
Carcinoma Squamous Cell	Squamous cell carcinoma	Pubtator	10628938, 16286998, 21674250, 24560559, 26061320, 26960457, 28724267, 29630085, 35264072	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma, Basal Cell	Carcinoma	BEFREE	10389945, 16857992, 29570129, 31012094, 9256917		★☆☆☆☆ Found in Text Mining only
Carcinoma, Neuroendocrine	Carcinoma	BEFREE	25674291		★☆☆☆☆ Found in Text Mining only
Carcinoma, Ovarian Epithelial	Ovarian Epithelial carcinoma	BEFREE	20226169, 24503464, 30272366, 7529065		★☆☆☆☆ Found in Text Mining only
Cardiomyopathies	Cardiomyopathy	BEFREE	25805750		★☆☆☆☆ Found in Text Mining only
Cardiomyopathy Dilated	Dilated cardiomyopathy	Pubtator	27025690	Associate	★☆☆☆☆ Found in Text Mining only
Cardiomyopathy, Dilated	Cardiomyopathy	LHGDN	18092954		★☆☆☆☆ Found in Text Mining only
Cardiomyopathy, Familial Idiopathic	Cardiomyopathy	BEFREE	23469238		★☆☆☆☆ Found in Text Mining only
Cardiovascular Diseases	Cardiovascular Diseases	BEFREE	23287867, 26861446, 28301500, 30695751, 31113468		★☆☆☆☆ Found in Text Mining only
Cardiovascular Diseases	Cardiovascular disease	Pubtator	26861446, 29724198, 31113468, 33581737, 35255964, 35397526	Associate	★☆☆☆☆ Found in Text Mining only
Celiac Disease	Celiac disease	BEFREE	26546613		★☆☆☆☆ Found in Text Mining only
Central Nervous System Diseases	Central nervous system disease	Pubtator	36550645, 7687897	Associate	★☆☆☆☆ Found in Text Mining only
Cerebral Infarction	Ischemic stroke	Pubtator	37418282	Associate	★☆☆☆☆ Found in Text Mining only
Cerebrovascular accident	Stroke	BEFREE	31555994		★☆☆☆☆ Found in Text Mining only
Cerebrovascular Disorders	Cerebrovascular disorder	Pubtator	30321232, 32321535	Associate	★☆☆☆☆ Found in Text Mining only
cervical cancer	Cervical Cancer	BEFREE	21163514, 29452694		★☆☆☆☆ Found in Text Mining only
Cervical Intraepithelial Neoplasia	Cervical Intraepithelial Neoplasia	BEFREE	30529837		★☆☆☆☆ Found in Text Mining only
Cervix carcinoma	Cervix carcinoma	BEFREE	21163514, 29452694		★☆☆☆☆ Found in Text Mining only
Childhood Acute Lymphoblastic Leukemia	Lymphoblastic Leukemia	BEFREE	10477734, 11531016, 12091359, 1548523, 15735032, 1696310, 16979235, 21792039, 22898323, 24400095, 25244981, 28730166, 29312795, 29772458, 7532767, 8946942, 9107079		★☆☆☆☆ Found in Text Mining only
Childhood Acute Myeloid Leukemia	Acute Myeloid Leukemia	BEFREE	18228020, 24574459		★☆☆☆☆ Found in Text Mining only
Childhood Ganglioglioma	Ganglioglioma	BEFREE	30308344		★☆☆☆☆ Found in Text Mining only
Childhood Oligodendroglioma	Oligodendroglioma	BEFREE	27812792		★☆☆☆☆ Found in Text Mining only
Cholangiocarcinoma	Cholangiocarcinoma	BEFREE	25519836		★☆☆☆☆ Found in Text Mining only
Cholangitis Sclerosing	Sclerosing cholangitis	Pubtator	11943728	Associate	★☆☆☆☆ Found in Text Mining only
Cholestasis	Cholestasis	BEFREE	28618047		★☆☆☆☆ Found in Text Mining only
Chondrosarcoma	Chondrosarcoma	Pubtator	22179165	Associate	★☆☆☆☆ Found in Text Mining only
Choriocarcinoma	Choriocarcinoma	BEFREE	16572634		★☆☆☆☆ Found in Text Mining only
Chromosome 5q Deletion Syndrome	Chromosome 5q deletion syndrome	Pubtator	17916100, 21211043	Associate	★☆☆☆☆ Found in Text Mining only
Chronic Disease	Chronic disease	Pubtator	27658882	Associate	★☆☆☆☆ Found in Text Mining only
Chronic granulomatous disease	Granulomatous Disease	BEFREE	10673720, 15507764, 19277017, 25288370, 30633606, 7517218, 8704221, 9057660, 9342375		★☆☆☆☆ Found in Text Mining only
Chronic heart failure	Heart Failure	BEFREE	31046425		★☆☆☆☆ Found in Text Mining only
Chronic Kidney Diseases	Kidney Disease	BEFREE	29729724, 30818167		★☆☆☆☆ Found in Text Mining only
Chronic Lymphocytic Leukemia	Lymphocytic Leukemia	BEFREE	10554806, 10556958, 15580304, 16225771, 23475845, 25185189, 28399885, 30237856, 9192749, 9209642		★☆☆☆☆ Found in Text Mining only
Chronic myeloproliferative disorder	Myeloproliferative disorder	BEFREE	17984313, 18723264, 19293402, 19387466, 19615425, 19762257, 19797525, 19850737, 20400977, 21785463, 22579713, 22864358, 24869939, 25557358, 25912019, 26011644, 26468945		★☆☆☆☆ Found in Text Mining only
Chronic Obstructive Airway Disease	Chronic Obstructive Pulmonary Disease	BEFREE	30064386, 31222587		★☆☆☆☆ Found in Text Mining only
Classical Lissencephalies and Subcortical Band Heterotopias	Lissencephaly	Pubtator	23341914	Associate	★☆☆☆☆ Found in Text Mining only
Clear-cell metastatic renal cell carcinoma	Renal Carcinoma	BEFREE	25142236		★☆☆☆☆ Found in Text Mining only
Cleft Lip	Cleft lip	Pubtator	28386053	Associate	★☆☆☆☆ Found in Text Mining only
Cleft Palate	Cleft palate	Pubtator	28186983	Associate	★☆☆☆☆ Found in Text Mining only
CNS disorder	CNS Disorder	BEFREE	14990803		★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	15498380, 16937436, 18720000, 19340613, 19350238, 20823141, 23239191, 25471788, 28002519, 28715802, 29970509		★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	19220296, 22824771, 23136548, 23180014, 23239191	Associate	★☆☆☆☆ Found in Text Mining only
Complete atrioventricular block	Complete Atrioventricular Block	BEFREE	25425463		★☆☆☆☆ Found in Text Mining only
Congenital amegakaryocytic thrombocytopenia	Congenital Amegakaryocytic Thrombocytopenia	BEFREE	23908116		★☆☆☆☆ Found in Text Mining only
Congenital arteriovenous malformation	Congenital Arteriovenous Malformation	BEFREE	24771337		★☆☆☆☆ Found in Text Mining only
Congenital chromosomal disease	Congenital Chromosomal Disease	BEFREE	10086729, 10557051, 10706073, 11426533, 12949884, 14692523, 15287942, 15701834, 16151585, 17474795, 18187662, 19004005, 21229640, 22623292, 7506635, 8123853, 8895688, 9436917, 9436918, 9763574		★☆☆☆☆ Found in Text Mining only
Congenital Mesoblastic Nephroma	Congenital Mesoblastic Nephroma	BEFREE	27020209		★☆☆☆☆ Found in Text Mining only
Congenital neutropenia	Congenital Neutropenia	BEFREE	11110716, 12554799, 12763135, 16079102, 19620402, 24394665		★☆☆☆☆ Found in Text Mining only
Congestive heart failure	Congestive Heart Failure	BEFREE	27523610, 29140957, 30243022, 31046425, 31360266		★☆☆☆☆ Found in Text Mining only
Connective Tissue Diseases	Connective Tissue Disease	BEFREE	30038095		★☆☆☆☆ Found in Text Mining only
Conventional (Clear Cell) Renal Cell Carcinoma	Renal Carcinoma	BEFREE	15095478, 28120493, 28287633, 31258725		★☆☆☆☆ Found in Text Mining only
Corneal Neovascularization	Corneal neovascularization	Pubtator	28724267	Associate	★☆☆☆☆ Found in Text Mining only
Coronary Arteriosclerosis	Coronary Arteriosclerosis	BEFREE	20078384		★☆☆☆☆ Found in Text Mining only
Coronary Artery Disease	Coronary artery disease	BEFREE	18192701, 20078384, 28918896, 29771429		★☆☆☆☆ Found in Text Mining only
Coronary Artery Disease	Coronary artery disease	Pubtator	18929243, 20078384, 20565948, 22855739	Associate	★☆☆☆☆ Found in Text Mining only
Coronary Disease	Coronary artery disease	Pubtator	18578002	Associate	★☆☆☆☆ Found in Text Mining only
Coronary heart disease	Coronary Heart Disease	BEFREE	20078384		★☆☆☆☆ Found in Text Mining only
Craniosynostosis	Craniosynostosis	BEFREE	30914376		★☆☆☆☆ Found in Text Mining only
Cushing Syndrome	Cushing syndrome	Pubtator	36555435	Associate	★☆☆☆☆ Found in Text Mining only
Cutaneous Fibrous Histiocytoma	Fibrous Histiocytoma	BEFREE	22523339, 28362700, 28609344, 30893190		★☆☆☆☆ Found in Text Mining only
Cyclic neutropenia	Cyclic neutropenia	Pubtator	11133754	Associate	★☆☆☆☆ Found in Text Mining only
Cyclic neutropenia	Cyclic Neutropenia	BEFREE	16079102		★☆☆☆☆ Found in Text Mining only
deficiency of adenosine deaminase 2	Adenosine deaminase 2 deficiency	Pubtator	35529868	Associate	★☆☆☆☆ Found in Text Mining only
Degenerative polyarthritis	Arthritis	BEFREE	29476097, 31257478		★☆☆☆☆ Found in Text Mining only
Demyelinating Diseases	Demyelinating Diseases	BEFREE	31017901		★☆☆☆☆ Found in Text Mining only
Dermatofibrosarcoma	Dermatofibrosarcoma	BEFREE	12661001, 19125742, 20061935, 26970672, 28045748, 29318761, 30187166, 7681857, 7693783, 8698923, 9700370		★☆☆☆☆ Found in Text Mining only
Dermatofibrosarcoma Protuberans	Dermatofibrosarcoma Protuberans	BEFREE	12502925, 12661001, 16126884, 17310000, 19125742, 20061935, 21478726, 21484928, 21570152, 22523339, 23108023, 23347652, 26488716, 26970672, 28045748, 28134725, 28362700, 28609344, 29140881, 29318761, 30024070, 30187166, 30952756, 7681857, 7693783, 8698923, 9550312, 9700370		★☆☆☆☆ Found in Text Mining only
Dermatomyositis	Dermatomyositis	BEFREE	30038095		★☆☆☆☆ Found in Text Mining only
Desmoid disease hereditary	Desmoid tumor	Pubtator	17090192, 33213169	Associate	★☆☆☆☆ Found in Text Mining only
Diabetes	Diabetes	BEFREE	20570185, 23144172, 23230080, 26283734, 26502796, 26861446, 28098485, 30312628, 30321232, 30549248, 31144511		★☆☆☆☆ Found in Text Mining only
Diabetes Gestational	Gestational diabetes	Pubtator	26494027, 28817576	Associate	★☆☆☆☆ Found in Text Mining only
Diabetes Gestational	Gestational diabetes	Pubtator	34557552	Inhibit	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes mellitus	Pubtator	18286257, 20570185, 23250986	Inhibit	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes Mellitus	BEFREE	20570185, 23144172, 23230080, 23250986, 26283734, 26360782, 26502796, 26861446, 28098485, 30312628, 30321232, 30549248, 31144511		★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes mellitus	Pubtator	22474430, 25159325, 26283734, 26360782, 28457994, 30321232, 31018749, 33572602, 35217004	Associate	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus Type 1	Diabetes mellitus, type 1	Pubtator	34267242	Associate	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus Type 2	Diabetes mellitus, type 2	Pubtator	27938493, 32358022, 35397526	Associate	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Insulin-Dependent	Diabetes Mellitus	BEFREE	28509690, 29455365, 30347712		★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Non-Insulin-Dependent	Diabetes Mellitus	BEFREE	29724198		★☆☆☆☆ Found in Text Mining only
Diabetic Retinopathy	Diabetic retinopathy	Pubtator	25159325, 26283734	Associate	★☆☆☆☆ Found in Text Mining only
Diabetic Retinopathy	Diabetic Retinopathy	BEFREE	25221423, 26283734, 26502796, 29488353		★☆☆☆☆ Found in Text Mining only
Disseminated Intravascular Coagulation	Disseminated Intravascular Coagulation	BEFREE	24206578, 9692814		★☆☆☆☆ Found in Text Mining only
Down Syndrome	Down Syndrome	BEFREE	11408071, 18689547, 24746204		★☆☆☆☆ Found in Text Mining only
Down Syndrome	Down syndrome	Pubtator	18689547	Associate	★☆☆☆☆ Found in Text Mining only
Duane Retraction Syndrome	Duane retraction syndrome	Pubtator	36869331	Associate	★☆☆☆☆ Found in Text Mining only
Dwarfism Pituitary	Pituitary dwarfism	Pubtator	28067847	Associate	★☆☆☆☆ Found in Text Mining only
Dysembryoplastic neuroepithelial tumor	Dysembryoplastic Neuroepithelial Tumor	BEFREE	23442159		★☆☆☆☆ Found in Text Mining only
Dyskeratosis Congenita	Dyskeratosis Congenita	BEFREE	18310499, 26546739		★☆☆☆☆ Found in Text Mining only
Dyskeratosis Congenita	Dyskeratosis congenita	Pubtator	18310499	Associate	★☆☆☆☆ Found in Text Mining only
Edema	Edema	Pubtator	24115077	Associate	★☆☆☆☆ Found in Text Mining only
Edema	Edema	Pubtator	39684754	Stimulate	★☆☆☆☆ Found in Text Mining only
Endometrial Carcinoma	Endometrial carcinoma	BEFREE	28498245		★☆☆☆☆ Found in Text Mining only
Endometrial Neoplasms	Endometrial neoplasm	Pubtator	21103625	Associate	★☆☆☆☆ Found in Text Mining only
Endometriosis	Endometriosis	Pubtator	19454514, 35628423	Associate	★☆☆☆☆ Found in Text Mining only
Eosinophilia	Eosinophilia	Pubtator	12871220	Associate	★☆☆☆☆ Found in Text Mining only
Ependymoma	Ependymoma	BEFREE	20367336		★☆☆☆☆ Found in Text Mining only
Epilepsy	Epilepsy	BEFREE	15311215, 28673671, 30308344		★☆☆☆☆ Found in Text Mining only
Epilepsy	Epilepsy	Pubtator	36307486	Associate	★☆☆☆☆ Found in Text Mining only
Epiretinal Membrane	Epiretinal Membrane	BEFREE	30768222		★☆☆☆☆ Found in Text Mining only
Epithelial ovarian cancer	Ovarian cancer	BEFREE	30272366		★☆☆☆☆ Found in Text Mining only
Epithelioid hemangioendothelioma	Epithelioid Hemangioendothelioma	BEFREE	16126886, 23288560, 28658152		★☆☆☆☆ Found in Text Mining only
Esophageal carcinoma	Esophageal Carcinoma	BEFREE	17682823, 29892805		★☆☆☆☆ Found in Text Mining only
Esophageal Neoplasms	Esophagus Neoplasm	BEFREE	17682823, 29892805		★☆☆☆☆ Found in Text Mining only
Esophageal Neoplasms	Esophageal neoplasm	Pubtator	28470572	Associate	★☆☆☆☆ Found in Text Mining only
Essential Tremor	Essential tremor	Pubtator	31610612	Associate	★☆☆☆☆ Found in Text Mining only
Ewings sarcoma	Ewing sarcoma	BEFREE	11706081, 16557578		★☆☆☆☆ Found in Text Mining only
Ewings sarcoma-primitive neuroectodermal tumor (PNET)	Ewing sarcoma	BEFREE	17369866		★☆☆☆☆ Found in Text Mining only
Fabry Disease	Fabry disease	Pubtator	33633114	Associate	★☆☆☆☆ Found in Text Mining only
Familial multiple trichoepitheliomata	Multiple Trichoepithelioma	BEFREE	28985034		★☆☆☆☆ Found in Text Mining only
Fanconi Anemia	Fanconi anemia	Pubtator	11698271, 17164793, 19277017, 29976742	Associate	★☆☆☆☆ Found in Text Mining only
Fanconi Anemia	Fanconi Anemia	BEFREE	17164793, 19277017, 21330473, 29976742, 7517716, 7552587, 8520833, 9322874		★☆☆☆☆ Found in Text Mining only
FANCONI ANEMIA, COMPLEMENTATION GROUP A (disorder)	Anemia	BEFREE	17164793, 19277017, 20485382, 21330473, 29976742, 7517716, 7552587, 8520833, 9322874		★☆☆☆☆ Found in Text Mining only
Fatigue Syndrome Chronic	Fatigue syndrome	Pubtator	27362406	Associate	★☆☆☆☆ Found in Text Mining only
Fatty Liver	Fatty liver	Pubtator	21225498	Stimulate	★☆☆☆☆ Found in Text Mining only
Fatty Liver Disease	Fatty Liver	BEFREE	30668625		★☆☆☆☆ Found in Text Mining only
Fibrofolliculoma	Fibrofolliculoma	BEFREE	30908293		★☆☆☆☆ Found in Text Mining only
Fibroid Tumor	Leiomyoma	LHGDN	12215337		★☆☆☆☆ Found in Text Mining only
Fibroid Tumor	Leiomyoma	BEFREE	25658015		★☆☆☆☆ Found in Text Mining only
fibroma	Fibroma	BEFREE	29940288		★☆☆☆☆ Found in Text Mining only
Fibromatosis	Fibromatosis	BEFREE	28821190		★☆☆☆☆ Found in Text Mining only
Fibrosis, Liver	Liver Fibrosis	BEFREE	21678408		★☆☆☆☆ Found in Text Mining only
Fleck corneal dystrophy	Fleck Corneal Dystrophy	BEFREE	27885945		★☆☆☆☆ Found in Text Mining only
Friedreich Ataxia	Friedreich Ataxia	BEFREE	31166002		★☆☆☆☆ Found in Text Mining only
Fuchs' Endothelial Dystrophy	Fuchs endothelial dystrophy	Pubtator	21757643	Associate	★☆☆☆☆ Found in Text Mining only
Gallbladder Neoplasms	Gallbladder neoplasm	Pubtator	20353905	Associate	★☆☆☆☆ Found in Text Mining only
Ganglioglioma	Ganglioglioma	BEFREE	12125736, 15311215, 23442159, 23941441, 30308344		★☆☆☆☆ Found in Text Mining only
Gastritis	Gastritis	Pubtator	16127019	Stimulate	★☆☆☆☆ Found in Text Mining only
Gastrointestinal Diseases	Gastrointestinal Diseases	BEFREE	30459058		★☆☆☆☆ Found in Text Mining only
Gastrointestinal Stromal Sarcoma	Gastrointestinal stromal tumor	BEFREE	14989743		★☆☆☆☆ Found in Text Mining only
Gastrointestinal Stromal Tumors	Gastrointestinal stromal tumor	BEFREE	10665649, 10751339, 10835530, 11005253, 11208730, 11213830, 11505412, 11507701, 11688571, 11706520, 11850541, 12152168, 12190287, 12375034, 12655446, 14989743, 15540118, 15742474, 16332719, 16398673, 16441423, 16586562, 16830365, 17090188, 17914946, 18223323, 18381383, 19690756, 20123583, 20180814, 21666577, 22952296, 23218903, 24133624, 26678977, 28074523, 28730166, 28744850, 28835241, 29245294, 29486292, 29592983, 29658593, 30292279, 30723856, 31570771, 9916914, 9916918		★☆☆☆☆ Found in Text Mining only
Gastrointestinal Stromal Tumors	Gastrointestinal stromal tumor	Pubtator	10665649, 10835530, 11035578, 12296756, 15540118, 15758577, 16126886, 16586562, 16830365, 17278201, 17623951, 18670346, 20123583, 20380900, 21655642, 21977985, 22395498, 23087281, 24133624, 25674291, 25759557, 26722584, 29018259, 33760802, 7520017, 9916914, 9916918	Associate	★☆☆☆☆ Found in Text Mining only
Gastrointestinal Stromal Tumors	Gastrointestinal stromal tumor	Pubtator	16361808, 9588894	Stimulate	★☆☆☆☆ Found in Text Mining only
Gastrointestinal Stromal Tumors	Gastrointestinal stromal tumor	LHGDN	16830365		★☆☆☆☆ Found in Text Mining only
Gastrointestinal Stromal Tumors	Gastrointestinal stromal tumor	Pubtator	31570771	Inhibit	★☆☆☆☆ Found in Text Mining only
GATA2 Deficiency	Gata2 deficiency	Pubtator	12670333	Associate	★☆☆☆☆ Found in Text Mining only
Gaucher Disease	Gaucher disease	Pubtator	29847668, 32086386, 7540881	Associate	★☆☆☆☆ Found in Text Mining only
Gaucher Disease	Gaucher Disease	BEFREE	9472564		★☆☆☆☆ Found in Text Mining only
Gaucher Disease, Type 1	Gaucher Disease	BEFREE	9472564		★☆☆☆☆ Found in Text Mining only
Gaucher Disease, Type 3 (disorder)	Gaucher Disease	BEFREE	1379609		★☆☆☆☆ Found in Text Mining only
Germ cell tumor	Tumor	BEFREE	9191534		★☆☆☆☆ Found in Text Mining only
Giant Cell Fibroblastoma	Giant Cell Fibroblastoma	BEFREE	12502925, 12661001, 16126884, 17310000, 19125742, 20061935, 21478726, 21484928, 21570152, 22523339, 23108023, 23347652, 26488716, 26970672, 28045748, 28134725, 28362700, 28609344, 29140881, 29318761, 30187166, 30952756, 7681857, 7693783, 8698923, 9550312, 9700370		★☆☆☆☆ Found in Text Mining only
Giant Cell Tumor of Bone	Giant cell tumor of bone	BEFREE	27384731		★☆☆☆☆ Found in Text Mining only
Giant Cell Tumor of Bone	Giant cell tumor of bone	Pubtator	27384731	Associate	★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	BEFREE	12744467, 22298889, 24129546, 28102487, 28193190, 28340100, 28771552, 29305787, 30226551, 31004262, 7523384		★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	Pubtator	19288188, 28102487, 28771552, 30226551, 33969682, 7523384	Associate	★☆☆☆☆ Found in Text Mining only
Glioblastoma Multiforme	Glioblastoma	BEFREE	22298889, 24129546, 28102487, 28193190, 28340100, 28771552, 29305787, 30226551, 31004262, 7523384		★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	BEFREE	23423309, 24857351, 29278874, 29310118, 31803626		★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	Pubtator	25478951, 33969682	Associate	★☆☆☆☆ Found in Text Mining only
Glomerulonephritis Membranous	Membranous glomerulonephritis	Pubtator	25875837	Associate	★☆☆☆☆ Found in Text Mining only
Graft vs Host Disease	Graft-versus-host disease	Pubtator	23313704, 27321893, 29325829, 29984829, 9787147	Associate	★☆☆☆☆ Found in Text Mining only
Graft-vs-Host Disease	Graft-Vs-Host Disease	BEFREE	12842426, 15356106, 15701981, 23313704, 24905022, 27333804, 29047161, 29431621, 29769208, 30342553		★☆☆☆☆ Found in Text Mining only
Granulomatous Disease Chronic	Granulomatous disease	Pubtator	25143186	Inhibit	★☆☆☆☆ Found in Text Mining only
Granulomatous Disease Chronic	Granulomatous disease	Pubtator	25288370, 7517218, 8704221, 9057660	Associate	★☆☆☆☆ Found in Text Mining only
Granulomatous Disease, Chronic, X-Linked	Granulomatous Disease	BEFREE	12393624, 12731085, 12817011, 12829597, 20978475, 25189742		★☆☆☆☆ Found in Text Mining only
Graves Disease	Graves disease	Pubtator	19897675, 22517745, 24517144, 24708100, 29752312, 32968816	Associate	★☆☆☆☆ Found in Text Mining only
Graves Disease	Graves Disease	BEFREE	21956421, 24446657, 24517144, 24708100, 24840811, 29847668		★☆☆☆☆ Found in Text Mining only
Graves Ophthalmopathy	Graves ophthalmopathy	Pubtator	19897675, 22517745, 23633206, 24086448, 24446657, 24708100, 26287404, 26325413, 29752312, 29847668, 32086386, 32968816, 34949642	Associate	★☆☆☆☆ Found in Text Mining only
Graves Ophthalmopathy	Graves ophthalmopathy	Pubtator	32176314	Stimulate	★☆☆☆☆ Found in Text Mining only
Gray Platelet Syndrome	Graves ophthalmopathy	Pubtator	28880435	Associate	★☆☆☆☆ Found in Text Mining only
Hamartoma	Hamartoma	BEFREE	20061935, 30811625		★☆☆☆☆ Found in Text Mining only
Head and Neck Carcinoma	Head And Neck Carcinoma	BEFREE	9815891		★☆☆☆☆ Found in Text Mining only
Heart Diseases	Heart disease	Pubtator	32896985, 37298503	Associate	★☆☆☆☆ Found in Text Mining only
Heart Failure	Heart failure	Pubtator	19380281, 20427614, 22519984, 24102302, 28790053, 29140957, 31360266	Associate	★☆☆☆☆ Found in Text Mining only
Heart failure	Heart Failure	BEFREE	27523610, 29140957, 30243022, 31360266		★☆☆☆☆ Found in Text Mining only
Heart Failure	Heart failure	Pubtator	36761158	Inhibit	★☆☆☆☆ Found in Text Mining only
Heart Neoplasm	Cardiac Neoplasms	BEFREE	30562734		★☆☆☆☆ Found in Text Mining only
Hemangioma	Hemangioma	BEFREE	14559986, 14576053, 28197761, 7693783		★☆☆☆☆ Found in Text Mining only
hemangiopericytoma	Hemangiopericytoma	BEFREE	25416841, 27773560, 29695573, 30036256		★☆☆☆☆ Found in Text Mining only
Hemangiosarcoma	Hemangiosarcoma	BEFREE	10640966, 9786357		★☆☆☆☆ Found in Text Mining only
Hematologic Diseases	Hematologic disease	Pubtator	15308329, 21886171, 33965183	Associate	★☆☆☆☆ Found in Text Mining only
Hematologic Neoplasms	Hematologic neoplasm	Pubtator	12842710, 15016645, 24680978, 27732563	Associate	★☆☆☆☆ Found in Text Mining only
Hematologic Neoplasms	Hematologic Neoplasms	BEFREE	23768928, 24680978, 29867960, 30831208, 31092732		★☆☆☆☆ Found in Text Mining only
Hematological Disease	Hematological Disease	BEFREE	16960339, 25189742, 26198043, 26394808		★☆☆☆☆ Found in Text Mining only
Hemoglobinopathies	Hemoglobinopathy	BEFREE	29431621		★☆☆☆☆ Found in Text Mining only
Hemoglobinuria Paroxysmal	Hemoglobinuria paroxysmal	Pubtator	12135676, 12411324, 12543108, 12668126, 14617023, 16131564, 17379072, 19013003, 7579441, 9028939, 9616145	Associate	★☆☆☆☆ Found in Text Mining only
Hemorrhage	Hemorrhage	Pubtator	27503021, 29572500	Associate	★☆☆☆☆ Found in Text Mining only
Hemorrhage	Hemorrhage	Pubtator	28102487	Stimulate	★☆☆☆☆ Found in Text Mining only
Hepatic Adenomas Familial	Hepatic adenoma	Pubtator	18602664	Associate	★☆☆☆☆ Found in Text Mining only
Hepatic Veno Occlusive Disease	Hepatic veno occlusive disease	Pubtator	28061766	Associate	★☆☆☆☆ Found in Text Mining only
Hepatitis B Chronic	Hepatitis b	Pubtator	25425463	Associate	★☆☆☆☆ Found in Text Mining only
Hepatoblastoma	Hepatoblastoma	BEFREE	12935928		★☆☆☆☆ Found in Text Mining only
Hepatoblastoma	Hepatoblastoma	Pubtator	34685577	Associate	★☆☆☆☆ Found in Text Mining only
Hepatomegaly	Hepatomegaly	Pubtator	36550645	Associate	★☆☆☆☆ Found in Text Mining only
Hereditary Breast and Ovarian Cancer Syndrome	Hereditary breast and ovarian cancer syndrome	Pubtator	16507917, 22207429, 7529065	Associate	★☆☆☆☆ Found in Text Mining only
Hirschsprung Disease	Hirschsprung Disease	BEFREE	24435644		★☆☆☆☆ Found in Text Mining only
Hirschsprung Disease	Hirschsprung disease	Pubtator	24475076	Associate	★☆☆☆☆ Found in Text Mining only
Histiocytoma Angiomatoid Fibrous	Angiomatoid fibrous histiocytoma	Pubtator	26261484	Associate	★☆☆☆☆ Found in Text Mining only
Histiocytoma, Benign Fibrous	Benign fibrous histiocytoma	BEFREE	7681857		★☆☆☆☆ Found in Text Mining only
Histiocytosis, Langerhans-Cell	Histiocytosis	BEFREE	16718746		★☆☆☆☆ Found in Text Mining only
Hodgkin Disease	Hodgkin Disease	BEFREE	20100355, 28339557, 30549248, 9326252		★☆☆☆☆ Found in Text Mining only
Huntington Disease	Huntington disease	Pubtator	2478216	Stimulate	★☆☆☆☆ Found in Text Mining only
Huntington Disease	Huntington Disease	BEFREE	28339557		★☆☆☆☆ Found in Text Mining only
Hyperglycemia	Hyperglycemia	Pubtator	31018749	Associate	★☆☆☆☆ Found in Text Mining only
Hyperhomocysteinemia	Hyperhomocysteinemia	BEFREE	25854700		★☆☆☆☆ Found in Text Mining only
Hyperplasia	Hyperplasia	Pubtator	24560559	Associate	★☆☆☆☆ Found in Text Mining only
Hypertension	Hypertension	Pubtator	21757643, 27367286	Associate	★☆☆☆☆ Found in Text Mining only
Hypertension Pulmonary	Pulmonary hypertension	Pubtator	30285886	Associate	★☆☆☆☆ Found in Text Mining only
Hypertensive disease	Hypertension	BEFREE	27562673, 28282559, 28619079, 29165175, 29192185, 31785607		★☆☆☆☆ Found in Text Mining only
Hyperthyroidism	Hyperthyroidism	BEFREE	19903799		★☆☆☆☆ Found in Text Mining only
Hypoglycemia	Hypoglycemia	BEFREE	29300991		★☆☆☆☆ Found in Text Mining only
Hypoxia	Hypoxia	Pubtator	20877435	Stimulate	★☆☆☆☆ Found in Text Mining only
Hypoxia	Hypoxia	Pubtator	26861446, 33958780, 36142656	Associate	★☆☆☆☆ Found in Text Mining only
Hypoxic-Ischemic Encephalopathy	Hypoxic-Ischemic Encephalopathy	BEFREE	28079317		★☆☆☆☆ Found in Text Mining only
Immune System Diseases	Immune system disease	Pubtator	21477850	Associate	★☆☆☆☆ Found in Text Mining only
Immune thrombocytopenic purpura	Immune Thrombocytopenic Purpura	BEFREE	11328281, 23028422		★☆☆☆☆ Found in Text Mining only
IMMUNODEFICIENCY 13	Immunodeficiency	BEFREE	31341106		★☆☆☆☆ Found in Text Mining only
Immunologic Deficiency Syndromes	Immunologic Deficiency Syndromes	BEFREE	11686940, 12208753, 12374689, 12560238, 14990803, 19155972, 19491395, 19855080, 20028384, 20378847, 21132730, 22053107, 22262762, 22551777, 22569301, 25102944, 25189742, 25193869, 25369030, 25519836, 25786870, 26048777, 26774386, 30059642, 31211147, 31569199, 31698451, 31769050, 7514050, 9389699		★☆☆☆☆ Found in Text Mining only
Inclusion Body Myositis (disorder)	Inclusion Body Myositis	BEFREE	30038095		★☆☆☆☆ Found in Text Mining only
Infantile hemangioma	Hemangioma	BEFREE	20870476, 31091531		★☆☆☆☆ Found in Text Mining only
Infantile malignant osteopetrosis	Malignant Osteopetrosis	BEFREE	23907031		★☆☆☆☆ Found in Text Mining only
Infantile myofibromatosis	myofibromatosis	BEFREE	8600777		★☆☆☆☆ Found in Text Mining only
Inflammatory Bowel Diseases	Inflammatory bowel disease	Pubtator	36571819	Associate	★☆☆☆☆ Found in Text Mining only
Inflammatory Myofibroblastic Tumor	Inflammatory Myofibroblastic Tumor	BEFREE	29764851		★☆☆☆☆ Found in Text Mining only
Insulin Resistance	Diabetes mellitus, type 2	Pubtator	27025690	Associate	★☆☆☆☆ Found in Text Mining only
Intestinal Diseases	Intestinal disease	Pubtator	36357104	Associate	★☆☆☆☆ Found in Text Mining only
Intraepithelial Neoplasia	Intraepithelial Neoplasia	BEFREE	29892805		★☆☆☆☆ Found in Text Mining only
Invasive Ductal Breast Carcinoma	Invasive Duct and Lobular Carcinoma	BEFREE	23469238		★☆☆☆☆ Found in Text Mining only
Ischemic stroke	Ischemic Stroke	BEFREE	29867719		★☆☆☆☆ Found in Text Mining only
Isolated somatotropin deficiency	Isolated Somatotropin Deficiency	BEFREE	28067847		★☆☆☆☆ Found in Text Mining only
Juvenile Myelomonocytic Leukemia	Myelomonocytic Leukemia	BEFREE	23065512, 25102944, 26983639, 27521329, 9432037		★☆☆☆☆ Found in Text Mining only
Kaposi Sarcoma	Kaposi Sarcoma	BEFREE	14559986, 31624759		★☆☆☆☆ Found in Text Mining only
Kidney Diseases	Kidney disease	Pubtator	19917374	Associate	★☆☆☆☆ Found in Text Mining only
Kidney Diseases	Kidney Disease	BEFREE	28870174		★☆☆☆☆ Found in Text Mining only
Kidney Neoplasms	Kidney neoplasm	Pubtator	31855296	Associate	★☆☆☆☆ Found in Text Mining only
L2 Acute Lymphoblastic Leukemia	Lymphoblastic Leukemia	BEFREE	8030658		★☆☆☆☆ Found in Text Mining only
Laryngeal Squamous Cell Carcinoma	Laryngeal Carcinoma	BEFREE	22800829		★☆☆☆☆ Found in Text Mining only
LATERAL MENINGOCELE SYNDROME	Lateral Meningocele Syndrome	BEFREE	21854753		★☆☆☆☆ Found in Text Mining only
Left Ventricular Hypertrophy	Left Ventricular Hypertrophy	BEFREE	28301500		★☆☆☆☆ Found in Text Mining only
Leiomyoma	Leiomyoma	Pubtator	25658015, 28324020, 30292626	Associate	★☆☆☆☆ Found in Text Mining only
Leiomyosarcoma	Leiomyosarcoma	Pubtator	28397202	Associate	★☆☆☆☆ Found in Text Mining only
leiomyosarcoma	Leiomyosarcoma	BEFREE	29318761		★☆☆☆☆ Found in Text Mining only
leukemia	Leukemia	BEFREE	10023011, 10500791, 10554806, 10797447, 10812243, 11704795, 11841446, 12070011, 12098070, 12446442, 15153610, 15356106, 15538732, 15668952, 15891774, 16079892, 1696310, 19679884, 20028384, 20053758, 20072157, 20601445, 20634376, 20724541, 21040219, 21911423, 22262762, 23180012, 23307033, 23446755, 23686525, 2395382, 23962073, 24517186, 2459568, 25538041, 25837664, 25896055, 25940713, 25957287, 26046801, 26338961, 2646903, 26837759, 27191650, 27311589, 27465508, 27732563, 27764235, 28025785, 28669578, 29431553, 31307525, 7540889, 7540903, 7579382, 7596170, 7627956, 7642463, 8677752, 9207416, 9209472, 9616142, 9720717		★☆☆☆☆ Found in Text Mining only
Leukemia	Leukemia	Pubtator	10477734, 10536003, 10797445, 11175493, 11389036, 11756187, 12031655, 12091359, 12446442, 12643264, 15108165, 15315976, 15493582, 16046526, 1713508, 17326052, 17412886, 17852445, 18271020, 18663149, 18757400, 19245435, 19556423, 19789352, 19805619, 19951974, 20714440, 21281967, 22024109, 22240607, 22258035, 23180012, 23233446, 23416210, 23536721, 24133598, 24339928, 24377566, 2460156, 24721792, 25360637, 25794001, 25847448, 26277663, 26819054, 27018867, 27447561, 27465508, 27732563, 28025785, 28133783, 28415626, 28718379, 30614203, 30952616, 31122263, 32037392, 32118299, 32245312, 32433559, 32697348, 32747558, 34706776, 35271751, 35421218, 35688455, 35973983, 36871092, 37812613, 37933409, 38095536, 7537932, 7540903, 7542497, 7687897, 7795240, 8123853, 8562943, 8704190, 8817092, 8895688, 9207439, 9707616	Associate	★☆☆☆☆ Found in Text Mining only
Leukemia Lymphoid	Lymphoid leukemia	Pubtator	26004809	Associate	★☆☆☆☆ Found in Text Mining only
Leukemia Myeloid	Myeloid leukemia	Pubtator	30049824, 38095536	Associate	★☆☆☆☆ Found in Text Mining only
Leukemia Myeloid Acute	Myeloid leukemia	Pubtator	10354136, 10553156, 10706073, 10733485, 10797445, 11473459, 11528095, 11739185, 11823047, 12417757, 12521365, 12717686, 1378322, 14585369, 15493582, 15668952, 16000576, 16470534, 16809615, 1708296, 1712640, 17340137, 17475913, 17852445, 17889721, 18085638, 18166786, 18200595, 18354176, 19010914, 19097174, 19197149, 19245435, 19429869, 19672946, 19781775, 19956772, 20203266, 20232575, 20435626, 20662087, 20805992, 20833819, 20938744, 21595920, 21596848, 21886171, 22024109, 22132193, 22258035, 23233446, 23416210, 24244383, 24284058, 24457336, 24739393, 24855276, 25093329, 25360637, 25890196, 25955299, 26083996, 26252775, 26439029, 26450753, 26637397, 2665849, 27008269, 27259275, 27663637, 28097942, 28133783, 28814980, 29155797, 29171939, 29720577, 30334347, 30414989, 30806567, 30848055, 30928626, 31171000, 31291985, 31611628, 31648334, 31739201, 31936647, 32037392, 32068780, 32245312, 32362618, 32747558, 33054115, 33147339, 33773558, 33794295, 33911178, 34053123, 35289472, 35320339, 35962395, 36197314, 36508705, 36966870, 37729123, 37933409, 38095536, 39506790, 7537931, 7537932, 7540889, 7542497, 7579382, 7579404, 7693036, 7693039, 8098967, 8562943, 8895688, 9002966, 9389707, 9616148, 9662278	Associate	★☆☆☆☆ Found in Text Mining only
Leukemia Myeloid Acute	Myeloid leukemia	Pubtator	25822503	Stimulate	★☆☆☆☆ Found in Text Mining only
Leukemia Myelomonocytic Chronic	Myelomonocytic leukemia	Pubtator	23065512, 29797327, 31048357	Associate	★☆☆☆☆ Found in Text Mining only
Leukemia Myelomonocytic Juvenile	Myelomonocytic leukemia	Pubtator	23756559	Stimulate	★☆☆☆☆ Found in Text Mining only
Leukemia Myelomonocytic Juvenile	Myelomonocytic leukemia	Pubtator	26983639, 32966606, 7537931, 9432037	Associate	★☆☆☆☆ Found in Text Mining only
Leukemia Promyelocytic Acute	Promyelocytic leukemia	Pubtator	11279655, 12827650, 15114596, 19291801, 20232575, 21148082, 22535601, 25045197, 25239423, 26819054, 27077772, 28533192, 37584196, 9734655	Associate	★☆☆☆☆ Found in Text Mining only
Leukemia, Mast-Cell	Leukemia	BEFREE	8283037		★☆☆☆☆ Found in Text Mining only
Leukemia, Myelocytic, Acute	Leukemia	BEFREE	10023011, 10329918, 10477734, 10482985, 10565299, 10706073, 10720135, 10721774, 10733509, 10812243, 10828005, 10880752, 10884796, 10914548, 10914549, 11158605, 11168757, 11264190, 11588023, 11726321, 11739185, 11843292, 11882366, 11943337, 12008077, 12139741, 12199781, 12200695, 12763135, 1378322, 14692523, 15339676, 15370243, 15642669, 15659725, 15668952, 15731354, 15746035, 16015647, 16029452, 16079892, 16094422, 16121216, 16151585, 16224484, 16321850, 16424870, 16524674, 16634964, 16643437, 16647568, 16740770, 16809615, 16828156, 16854822, 16920565, 17039238, 17043643, 17063086, 17076533, 17259349, 17339182, 17340137, 17379067, 17442773, 17475913, 17598835, 18173753, 18187662, 18200595, 18212737, 18249061, 18318772, 18422993, 18640764, 18702870, 19036083, 19074734, 19079347, 19097174, 19148132, 19245435, 19277587, 19383813, 19421145, 19429869, 19556423, 19568712, 19672946, 1974471, 19781775, 19805619, 19819294, 20028384, 20053758, 20143914, 20200557, 20203266, 20211576, 20227111, 20232575, 20400977, 20435626, 20444543, 20498303, 20505189, 20535151, 20634376, 20699435, 20810927, 20833819, 20855866, 20938744, 21135860, 21150891, 21330473, 21470678, 21546568, 21595920, 21689085, 21739277, 21760593, 21768886, 21812014, 21917756, 22053107, 22064349, 22132193, 22162288, 22207736, 22258035, 22262762, 22289983, 22532518, 22898323, 22914610, 23055153, 23077289, 23233446, 23238897, 23247046, 23416210, 23473997, 23473998, 23496932, 23604035, 23701943, 23867470, 23891751, 23906301, 24103301, 24283803, 24377566, 24441947, 24457336, 24477595, 24517186, 24574459, 24721792, 24855276, 25015859, 25144719, 25174404, 25184385, 25287709, 25331116, 25545165, 25600023, 25706801, 25890196, 25940713, 25955299, 25990244, 26010294, 26059451, 26202421, 26351014, 26387755, 2646903, 26678889, 27008269, 27063991, 27065320, 27258612, 27340869, 27377587, 27465508, 27514505, 27595757, 28097942, 28301528, 28359030, 2851073, 28569789, 28678809, 28679949, 28805931, 29065396, 29208365, 29254227, 29274134, 29288821, 29774987, 29883944, 30171088, 30334334, 30342553, 30352278, 30550585, 30740913, 30848055, 31002948, 31171000, 31316209, 31500210, 31536492, 31618690, 31623402, 31831875, 7506635, 7509165, 7516029, 7517211, 7528566, 7532058, 7536510, 7579382, 7742754, 7769842, 8562934, 8562943, 8637238, 8677752, 8895688, 9124211, 9156652, 9205006, 9220659, 9322679, 9436917, 9639418, 9680107, 9858225		★☆☆☆☆ Found in Text Mining only
Leukemia, Myelocytic, Acute	Leukemia	LHGDN	12161354, 15569991, 18085638		★☆☆☆☆ Found in Text Mining only
Leukemia, Myelomonocytic, Chronic	Myelomonocytic Leukemia	BEFREE	17041567, 23065512, 23415111, 25965571, 27521329, 31623402		★☆☆☆☆ Found in Text Mining only
Leukemia, T-Cell	T-cell leukemia	BEFREE	10455355, 18818438		★☆☆☆☆ Found in Text Mining only
Leukocyte adhesion deficiency type 1	Leukocyte adhesion deficiency	Pubtator	9473215	Associate	★☆☆☆☆ Found in Text Mining only
Leukodystrophy Metachromatic	Metachromatic leukodystrophy	Pubtator	31150018	Associate	★☆☆☆☆ Found in Text Mining only
Leukopenia	Leukopenia	BEFREE	11571507		★☆☆☆☆ Found in Text Mining only
LIMB-MAMMARY SYNDROME	Limb-Mammary Syndrome	BEFREE	21854753		★☆☆☆☆ Found in Text Mining only
Lipoma	Lipoma	BEFREE	19558598		★☆☆☆☆ Found in Text Mining only
Lipoma	Lipoma	Pubtator	23786924, 26327807	Associate	★☆☆☆☆ Found in Text Mining only
Lipomatosis, Multiple	Lipomatosis	BEFREE	19558598		★☆☆☆☆ Found in Text Mining only
Liposarcoma, Dedifferentiated	liposarcoma	BEFREE	23770802, 26970672		★☆☆☆☆ Found in Text Mining only
Liposarcoma, Myxoid	liposarcoma	BEFREE	26970672		★☆☆☆☆ Found in Text Mining only
Liposarcoma, well differentiated	liposarcoma	BEFREE	10981875		★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	10068108, 17931370, 18422751, 20471664, 21052098, 24465741, 25519836, 25701390, 26243063, 26676820, 28914714, 29429512, 29563807, 29629949, 30026837, 30177788, 30598262, 31609020, 31611584, 31828297, 7539239		★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	CTD_human_DG	28284560		★☆☆☆☆ Found in Text Mining only
Liver Cirrhosis	Liver Cirrhosis	LHGDN	17786144		★☆☆☆☆ Found in Text Mining only
Liver Cirrhosis	Liver cirrhosis	Pubtator	20629423, 25425463	Associate	★☆☆☆☆ Found in Text Mining only
Liver Cirrhosis	Liver Cirrhosis	BEFREE	28903414		★☆☆☆☆ Found in Text Mining only
Liver Diseases	Liver disease	Pubtator	25331524	Associate	★☆☆☆☆ Found in Text Mining only
Liver Diseases Alcoholic	Liver disease	Pubtator	25331524	Associate	★☆☆☆☆ Found in Text Mining only
Liver Neoplasms	Liver neoplasm	Pubtator	27090685	Associate	★☆☆☆☆ Found in Text Mining only
Localized scleroderma	Scleroderma	BEFREE	26156537, 29888507, 8599452		★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung neoplasms	Pubtator	26472724, 34717573	Associate	★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus Systemic	Systemic lupus erythematosus	Pubtator	17764548, 19180486, 38347676	Associate	★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus, Systemic	Lupus Erythematosus	BEFREE	17764548		★☆☆☆☆ Found in Text Mining only
Lupus Nephritis	Lupus Nephritis	BEFREE	16948133		★☆☆☆☆ Found in Text Mining only
Lupus Nephritis	Lupus nephritis	Pubtator	16948133	Associate	★☆☆☆☆ Found in Text Mining only
Lymphangioma	Lymphangioma	BEFREE	14559986		★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic Metastasis	BEFREE	21089052		★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic metastasis	Pubtator	24083700, 28724267, 29745079, 30229826	Associate	★☆☆☆☆ Found in Text Mining only
Lymphedema	Lymphedema	Pubtator	8731104	Associate	★☆☆☆☆ Found in Text Mining only
Lymphoid leukemia	Lymphoid leukemia	BEFREE	11843292, 17646667, 19762535, 23178754, 30059823, 8562934, 9114595		★☆☆☆☆ Found in Text Mining only
Lymphoma	Lymphoma	BEFREE	10861809, 11328295, 16797410, 20980506, 31618456, 9614561		★☆☆☆☆ Found in Text Mining only
Lymphoma	Lymphoma	Pubtator	10861809, 16797410, 7683923, 8874217	Associate	★☆☆☆☆ Found in Text Mining only
Lymphoma Follicular	Lymphoma	Pubtator	10050723, 15147376, 8541563, 9160682, 9827925	Associate	★☆☆☆☆ Found in Text Mining only
Lymphoma, Follicular	Lymphoma	BEFREE	8541563, 9827925		★☆☆☆☆ Found in Text Mining only
Lymphoma, Non-Hodgkin	Non-Hodgkin lymphoma	BEFREE	11019838, 15654349, 16797410, 17570320, 7534139		★☆☆☆☆ Found in Text Mining only
Lymphoma, Non-Hodgkin, Familial	Lymphoma	BEFREE	11019838, 16797410, 7534139		★☆☆☆☆ Found in Text Mining only
Lymphopenia	Lymphopenia	BEFREE	30831208, 31149945		★☆☆☆☆ Found in Text Mining only
Macular Degeneration	Macular degeneration	Pubtator	24466138	Associate	★☆☆☆☆ Found in Text Mining only
Macular Degeneration	Macular degeneration	Pubtator	36899935	Stimulate	★☆☆☆☆ Found in Text Mining only
Major Depressive Disorder	Mental Depression	PSYGENET_DG	18180758		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Malignant Glioma	Glioma	BEFREE	31841105		★☆☆☆☆ Found in Text Mining only
Malignant Head and Neck Neoplasm	Head and neck cancer	BEFREE	9815891		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	10389945, 10811478, 12208755, 18165897, 23053664, 25652007, 26294068, 26470709, 29745079, 30229826, 30320661, 8978310		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of esophagus	Esophagus Neoplasm	BEFREE	17682823, 29892805		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of liver	Liver Cancer	BEFREE	25519836, 25867583		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of lung	Lung Cancer	BEFREE	28004467, 28339070		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of ovary	Ovarian cancer	BEFREE	20226169, 24364465, 24503464, 7529065		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of pancreas	Pancreatic cancer	BEFREE	16552335		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	BEFREE	28408238, 28730786		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of skin	Skin cancer	BEFREE	25736275		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of stomach	Stomach Neoplasms	BEFREE	11458276, 12767510, 18200665, 20383661, 21089052, 28574630, 29881296, 30292405, 31702632		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of thyroid	Thyroid cancer	BEFREE	27577959		★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	10455355, 10583234, 15287943, 15769738, 17234786, 22994764, 23053664, 23345163, 23887307, 23918796, 24154923, 24364465, 25038231, 25492485, 25519836, 26294068, 26484608, 26846996, 27097319, 27384731, 28399903, 29076783, 29113290, 29245936, 29429512, 29521047, 29745079, 29769208, 29892805, 30187166, 30442385, 31828297, 9728931, 9815891		★☆☆☆☆ Found in Text Mining only
Malignant Peripheral Nerve Sheath Tumor	Malignant Peripheral Nerve Sheath Tumor	BEFREE	28551330		★☆☆☆☆ Found in Text Mining only
Malignant Squamous Cell Neoplasm	Neoplasm	BEFREE	17310847		★☆☆☆☆ Found in Text Mining only
Malignant tumor of cervix	Cervical Tumor	BEFREE	21163514, 29452694		★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	BEFREE	20707719, 29066178, 29212519		★☆☆☆☆ Found in Text Mining only
Marfan Syndrome	Marfan Syndrome	BEFREE	16820603		★☆☆☆☆ Found in Text Mining only
Marfan Syndrome	Marfan syndrome	Pubtator	34326362	Associate	★☆☆☆☆ Found in Text Mining only
Mastocytosis	Mastocytosis	BEFREE	11493470, 17587883, 21878676, 22963840, 31794934		★☆☆☆☆ Found in Text Mining only
Mastocytosis	Mastocytosis	Pubtator	11493470, 21878676, 31698677, 7522630	Associate	★☆☆☆☆ Found in Text Mining only
Mastocytosis Systemic	Systemic mastocytosis	Pubtator	21878676	Associate	★☆☆☆☆ Found in Text Mining only
Mastocytosis, Systemic	Mastocytosis	BEFREE	16321850, 16505282, 21878676, 26001169, 29223146		★☆☆☆☆ Found in Text Mining only
Melanocytic nevus	Melanocytic nevus	LHGDN	18813945		★☆☆☆☆ Found in Text Mining only
Melanoma	Melanoma	Pubtator	11747338	Associate	★☆☆☆☆ Found in Text Mining only
melanoma	Melanoma	BEFREE	11943337, 23877751, 29695573, 31362777		★☆☆☆☆ Found in Text Mining only
melanoma	Melanoma	LHGDN	18813945		★☆☆☆☆ Found in Text Mining only
Melanoma Cutaneous Malignant	Melanoma	Pubtator	17429142	Associate	★☆☆☆☆ Found in Text Mining only
Meningioma	Meningioma	Pubtator	16245214	Associate	★☆☆☆☆ Found in Text Mining only
Meningioma	Meningioma	BEFREE	17473381, 24252471, 30503291		★☆☆☆☆ Found in Text Mining only
Mental Retardation, X-Linked	Mental retardation	BEFREE	30051533		★☆☆☆☆ Found in Text Mining only
Mesial temporal lobe epilepsy with hippocampal sclerosis	Mesial temporal lobe epilepsy with hippocampal sclerosis	BEFREE	29476662		★☆☆☆☆ Found in Text Mining only
Metabolic Syndrome X	Metabolic Syndrome	BEFREE	26372179		★☆☆☆☆ Found in Text Mining only
Metastatic Dermatofibrosarcoma Protuberans	Metastatic Dermatofibrosarcoma Protuberans	BEFREE	28607608, 29140881		★☆☆☆☆ Found in Text Mining only
Microvascular Angina	Microvascular angina	Pubtator	17194713	Associate	★☆☆☆☆ Found in Text Mining only
Miller Dieker syndrome	Miller Dieker Syndrome	BEFREE	17895401, 19079347, 20345447, 21135860, 22465474, 25428262		★☆☆☆☆ Found in Text Mining only
Mixed phenotype acute leukemia	Mixed Phenotype Leukemia	BEFREE	1705862		★☆☆☆☆ Found in Text Mining only
Monoclonal Gammopathy of Undetermined Significance	Monoclonal Gammapathies	BEFREE	15334545		★☆☆☆☆ Found in Text Mining only
Morphea	Morphea	BEFREE	26156537, 29888507, 8599452		★☆☆☆☆ Found in Text Mining only
Mouth Diseases	Mouth disease	Pubtator	32730419	Stimulate	★☆☆☆☆ Found in Text Mining only
Mucopolysaccharidosis I	Mucopolysaccharidosis	BEFREE	15538732		★☆☆☆☆ Found in Text Mining only
Mucopolysaccharidosis II	Mucopolysaccharidosis	BEFREE	12516048		★☆☆☆☆ Found in Text Mining only
Mucopolysaccharidosis VI	Mucopolysaccharidosis	BEFREE	12969636		★☆☆☆☆ Found in Text Mining only
Mucopolysaccharidosis VII	Mucopolysaccharidosis	BEFREE	15194052		★☆☆☆☆ Found in Text Mining only
Multiple Acyl Coenzyme A Dehydrogenase Deficiency	Multiple Acyl-CoA Dehydrogenase Deficiency	BEFREE	31169683		★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Multiple myeloma	Pubtator	10068658, 10086793, 10520008, 11146157, 11823041, 16278377, 17626627, 19792049, 25793710, 33142253, 7540888, 8652382, 9057669, 9345032, 9753067	Associate	★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Multiple myeloma	BEFREE	10515895, 10690543, 11146157, 12374689, 17895401, 17927494, 18608354, 23357980, 24072855, 25278456, 25793710, 27001243, 28669690, 29390394, 31618456, 31753774, 31830371, 7524734, 7540887, 7540888, 7742754, 8652382, 9057669, 9436938		★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Multiple myeloma	Pubtator	20971816	Inhibit	★☆☆☆☆ Found in Text Mining only
Multiple Sclerosis	Multiple Sclerosis	BEFREE	20098455, 22252466, 24664166, 24687904		★☆☆☆☆ Found in Text Mining only
Muscular Dystrophy Duchenne	Duchenne muscular dystrophy	Pubtator	18493616, 19144182, 32157826	Associate	★☆☆☆☆ Found in Text Mining only
Muscular Dystrophy Duchenne	Duchenne muscular dystrophy	Pubtator	24843230	Stimulate	★☆☆☆☆ Found in Text Mining only
Myelodysplasia	Myelodysplasia	BEFREE	7532058, 8695798		★☆☆☆☆ Found in Text Mining only
MYELODYSPLASTIC SYNDROME	Myelodysplastic Syndrome	BEFREE	10733509, 10979941, 11027834, 11435325, 11698291, 12070035, 12094256, 12411319, 12620294, 12949884, 15287942, 15370243, 15548716, 15677568, 15982348, 16524674, 16634964, 16682076, 16940419, 17043643, 17570514, 17616640, 17895401, 18043245, 18477045, 18637807, 18663149, 18945969, 19061215, 19079347, 19135900, 19152102, 19438482, 19644139, 19773257, 19801443, 20061558, 20143914, 20331463, 20345447, 20562331, 20621626, 20801506, 20869114, 21135860, 21150891, 21447369, 21527522, 21532034, 21967505, 22271903, 22419576, 22465474, 22513084, 22524974, 22580751, 22753872, 22784712, 22929976, 22983574, 23047726, 23065512, 23071274, 23219618, 23246221, 23339109, 23471304, 23475532, 23603914, 23604035, 23623559, 23797473, 23962073, 24559255, 24850867, 24855276, 25122688, 25225797, 25344522, 25428262, 25810490, 25924846, 25965571, 26147687, 26355708, 26394808, 26617797, 27020498, 27077769, 27311589, 27521329, 27683035, 27789361, 28359030, 28472271, 28618451, 28669578, 28691152, 29288821, 29387203, 30025279, 30223454, 30334347, 30334700, 30335886, 30587636, 31211490, 31623402, 7516887, 7532058, 8695798, 8943864, 9209472, 9885439		★☆☆☆☆ Found in Text Mining only
MYELODYSPLASTIC SYNDROME	Myelodysplastic Syndrome	LHGDN	15569991		★☆☆☆☆ Found in Text Mining only
Myelodysplastic Syndrome with Isolated del(5q)	Myelodysplastic syndrome	BEFREE	18477045		★☆☆☆☆ Found in Text Mining only
Myelodysplastic Syndromes	Myelodysplastic syndrome	Pubtator	10706073, 11027834, 12070035, 12210602, 12411319, 12670333, 12949884, 15287942, 15315976, 15352984, 15781334, 15982348, 16470534, 16527891, 16574954, 16980411, 17090657, 17570514, 17616640, 18061946, 18945969, 19135900, 19240791, 19438482, 19644139, 19644143, 19801443, 20061558, 20562331, 20633296, 20662087, 21150891, 21189329, 21886171, 22271903, 22419576, 22753872, 22983574, 23071274, 23155256, 23301363, 23475532, 23538751, 23554290, 23765228, 24559255, 24690917, 24850867, 25122688, 25225797, 25344522, 25368817, 25472472, 26617797, 27571714, 29325829, 30334347, 30587636, 30806567, 30928626, 30987070, 32299093, 33054116, 33462268, 34548471, 36966870, 37933409, 37986081, 38575672, 39711284, 7528567, 7537931, 8704190, 8943864, 9792306, 9886323	Associate	★☆☆☆☆ Found in Text Mining only
Myelodysplastic Syndromes	Myelodysplastic syndrome	Pubtator	35289472	Stimulate	★☆☆☆☆ Found in Text Mining only
Myelofibrosis	Myelofibrosis	BEFREE	11703327, 11721970, 14513050, 15849170, 18515659, 23445613, 25193869, 25461253, 27114459, 7536510, 7688180, 8977245		★☆☆☆☆ Found in Text Mining only
Myeloid Leukemia	Myeloid Leukemia	BEFREE	10621836, 7536510		★☆☆☆☆ Found in Text Mining only
Myeloid Leukemia, Chronic	Myeloid Leukemia	BEFREE	10037010, 10360384, 10428273, 10477734, 10477735, 10480429, 10500825, 10557051, 10583234, 10621836, 10727459, 10784402, 10888114, 10973491, 11243401, 11264175, 11290604, 11477437, 11777957, 11861294, 12028025, 12144534, 12200668, 12394842, 12446442, 12589034, 12591277, 12829595, 14562121, 14751929, 15050747, 15068908, 15153610, 15287917, 15674360, 15701834, 15806158, 15815728, 15958636, 16204063, 16224484, 16293596, 16505282, 16939497, 16952195, 17218385, 17252012, 17284533, 17349636, 17634558, 17717066, 17925491, 18409031, 18550858, 18757400, 18781299, 18820130, 18922853, 18936234, 19074734, 19074828, 19723894, 19855080, 19887785, 19934315, 20103624, 20103647, 20147974, 20684991, 20724541, 20805474, 21123820, 21132730, 21158719, 21252986, 21400515, 21478667, 21483442, 21519342, 21535879, 21653319, 21693596, 21890458, 21911423, 21931114, 21933581, 22089930, 22285998, 22372463, 22387217, 22517301, 22592606, 22868969, 23180012, 23341130, 23341351, 23400594, 23887971, 23970380, 24364873, 24445143, 24574458, 24778155, 25465126, 25515961, 25573989, 25712455, 25721898, 25837664, 25849484, 25965880, 26118501, 26460262, 26607600, 26629937, 26706195, 26966074, 27040932, 27581149, 28233439, 28368400, 28533480, 28599273, 28730166, 28789422, 28905209, 28962554, 29428725, 29774100, 30091999, 30864683, 7492787, 7509165, 7509222, 7536510, 7541674, 7742754, 7786800, 8683978, 9202056, 9305602, 9529140, 9558400, 9680367, 9716614, 9746786, 9789216, 9864172		★☆☆☆☆ Found in Text Mining only
Myeloid Leukemia, Chronic	Myeloid Leukemia	LHGDN	17449014, 18922853		★☆☆☆☆ Found in Text Mining only
Myeloproliferative disease	Myeloproliferative disorder	BEFREE	16373657, 19797525, 20400977, 26468945, 27427771		★☆☆☆☆ Found in Text Mining only
Myeloproliferative Disorders	Myeloproliferative disorder	Pubtator	16373657, 19196660	Associate	★☆☆☆☆ Found in Text Mining only
Myocardial Infarction	Myocardial Infarction	LHGDN	18292296		★☆☆☆☆ Found in Text Mining only
Myocardial Infarction	Myocardial infarction	Pubtator	18752636, 26861446, 31360266, 37298503, 37952030	Associate	★☆☆☆☆ Found in Text Mining only
Myocardial Infarction	Myocardial Infarction	BEFREE	26553339, 27956416, 31116952, 31360266		★☆☆☆☆ Found in Text Mining only
Myocardial Ischemia	Myocardial Ischemia	BEFREE	20447441		★☆☆☆☆ Found in Text Mining only
Myofibromatosis	Myofibromatosis	BEFREE	8600777		★☆☆☆☆ Found in Text Mining only
Myositis	Myositis	BEFREE	30038095		★☆☆☆☆ Found in Text Mining only
Myositis Inclusion Body	Myositis	Pubtator	23058947	Associate	★☆☆☆☆ Found in Text Mining only
Nasal Polyps	Nasal polyp	Pubtator	30720103	Associate	★☆☆☆☆ Found in Text Mining only
Necrosis	Necrosis	Pubtator	23469238	Inhibit	★☆☆☆☆ Found in Text Mining only
Necrosis	Necrosis	Pubtator	23887307	Associate	★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	10360384, 10515895, 10733509, 10981875, 11005253, 11023095, 11063223, 11150369, 11458276, 11472565, 11522651, 11764072, 11793370, 11914602, 12409719, 12624789, 14512938, 14719061, 15095478, 15149745, 15163009, 15224284, 15311215, 15334632, 15613855, 15633219, 15654349, 15846102, 16126884, 16203624, 16332719, 16355400, 16820881, 16847924, 16918299, 16941013, 17069596, 17107337, 17310000, 17357004, 17369866, 17513510, 17544169, 17587883, 17631880, 17643098, 17950782, 18069662, 18077429, 18253748, 18371232, 18448146, 18726131, 18955754, 19069638, 19125742, 19280118, 19850893, 20052466, 20061935, 20075160, 20096441, 20211576, 20228779, 20367336, 20393746, 20637435, 20704656, 20707719, 20709701, 20959494, 21052098, 21124918, 21247411, 21478726, 21531285, 21570152, 21660060, 21670270, 21728393, 21988227, 22198428, 22260501, 22510877, 22613995, 22842937, 22863759, 22945372, 23053664, 23185544, 23442159, 23455180, 23469238, 23470565, 23491253, 23605004, 23681076, 23770802, 23783436, 23838926, 23887307, 24018658, 24124726, 24294391, 24300090, 24750000, 24824261, 25119741, 25326586, 25359683, 25369030, 25478951, 25492485, 25519836, 25571952, 25652007, 25658015, 25672594, 25776770, 25879429, 25914189, 26083570, 26107202, 26337721, 26564429, 26611645, 26631613, 26968831, 27145123, 27287478, 27384731, 27461628, 27583351, 27636918, 27685922, 27984233, 28008146, 28035704, 28054210, 28102487, 28322833, 28363643, 28420432, 28420485, 28469969, 28497509, 28521454, 28533703, 28643792, 28851664, 28914714, 28927093, 28938000, 29066509, 29076783, 29077706, 29079308, 29162156, 29180874, 29257041, 29305787, 29400366, 29420334, 29474318, 29480877, 29521047, 29629949, 29695573, 29701169, 29748768, 29749553, 29769208, 29881296, 29926253, 30031097, 30071515, 30169623, 30178842, 30179776, 30183767, 30200169, 30204258, 30233017, 30263099, 30272366, 30276917, 30292626, 30304859, 30308344, 30320661, 30334990, 30445975, 30451731, 30503291, 30562734, 30569527, 30675255, 30820651, 30943862, 30968151, 31236332, 31336612, 31474003, 31536492, 31605494, 31658324, 31693501, 31760702, 7534671, 7540888, 7817937, 8290310, 8652382, 8698923, 9191534, 9256917, 9436938, 9704611		★☆☆☆☆ Found in Text Mining only
Nephritis	Nephritis	BEFREE	26048777		★☆☆☆☆ Found in Text Mining only
Nephroblastoma	Nephroblastoma	BEFREE	10674900, 11841446, 15749664, 17379072, 21135860, 24405639, 25398938, 30955364, 9028964		★☆☆☆☆ Found in Text Mining only
Nephrogenic Fibrosing Dermopathy	Nephrogenic Fibrosing Dermopathy	BEFREE	20462761		★☆☆☆☆ Found in Text Mining only
Neural Tube Defects	Neural tube defect	Pubtator	10759717, 16470534, 17898317, 8695798	Associate	★☆☆☆☆ Found in Text Mining only
Neurilemmoma	Neurilemmoma	BEFREE	10835530		★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	BEFREE	10337918, 11431345, 12208753, 12767104, 26054597, 30572519, 30689374, 9516847		★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	Pubtator	19141404, 32979173	Associate	★☆☆☆☆ Found in Text Mining only
Neuroendocrine Tumors	Neuroendocrine Tumors	BEFREE	19212638, 28982917		★☆☆☆☆ Found in Text Mining only
Neurofibromatosis 1	Neurofibromatosis	Pubtator	32966606	Stimulate	★☆☆☆☆ Found in Text Mining only
Neutropenia	Neutropenia	BEFREE	11571507		★☆☆☆☆ Found in Text Mining only
Neutropenia	Neutropenia	Pubtator	12829030, 7540888	Associate	★☆☆☆☆ Found in Text Mining only
Neutropenia Severe Congenital Autosomal Recessive 3	Severe congenital neutropenia	Pubtator	10590052, 30615903, 32325141	Associate	★☆☆☆☆ Found in Text Mining only
Neutropenia Severe Congenital Autosomal Recessive 3	Severe congenital neutropenia	Pubtator	11110716	Inhibit	★☆☆☆☆ Found in Text Mining only
Niemann-Pick Disease, Type C1	Sphingomyelinase deficiency	BEFREE	27860245		★☆☆☆☆ Found in Text Mining only
Nodular fasciitis	Nodular Fasciitis	BEFREE	30168888		★☆☆☆☆ Found in Text Mining only
Non-Small Cell Lung Carcinoma	Lung carcinoma	BEFREE	15328478, 16849585, 21333372, 27573351, 28345466, 29599314, 31611984, 31760702		★☆☆☆☆ Found in Text Mining only
Noninfiltrating Intraductal Carcinoma	Ductal carcinoma	BEFREE	23469238		★☆☆☆☆ Found in Text Mining only
Nonorganic psychosis	Nonorganic Psychosis	BEFREE	24246416		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Nonorganic psychosis	Nonorganic Psychosis	PSYGENET_DG	24246416		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Oculocutaneous albinism type 2	Oculocutaneous albinism	Pubtator	25621687	Stimulate	★☆☆☆☆ Found in Text Mining only
oligodendroglioma	Oligodendroglioma	BEFREE	27812792		★☆☆☆☆ Found in Text Mining only
Oligodendroglioma	Oligodendroglioma	Pubtator	27812792	Associate	★☆☆☆☆ Found in Text Mining only
Oral Submucous Fibrosis	Oral Submucous Fibrosis	BEFREE	30197335		★☆☆☆☆ Found in Text Mining only
Oral Submucous Fibrosis	Oral submucous fibrosis	Pubtator	30197335, 31854369	Associate	★☆☆☆☆ Found in Text Mining only
Osteoarthritis	Osteoarthritis	Pubtator	21953087, 31257478, 32245507, 34571845	Associate	★☆☆☆☆ Found in Text Mining only
Osteochondritis Dissecans	Osteochondritis Dissecans	BEFREE	28770227		★☆☆☆☆ Found in Text Mining only
Osteoporosis	Osteoporosis	Pubtator	22226689	Associate	★☆☆☆☆ Found in Text Mining only
Osteoporosis, Postmenopausal	Osteoporosis	BEFREE	20554181		★☆☆☆☆ Found in Text Mining only
Osteosarcoma	Osteosarcoma	Pubtator	22009965	Associate	★☆☆☆☆ Found in Text Mining only
Ovarian Failure, Premature	Ovarian Failure	BEFREE	31034039		★☆☆☆☆ Found in Text Mining only
Ovarian Granulosa Cell Tumor	Ovarian Tumor	BEFREE	12911721		★☆☆☆☆ Found in Text Mining only
ovarian neoplasm	Ovarian neoplasm	BEFREE	20226169, 24364465, 24503464, 7529065		★☆☆☆☆ Found in Text Mining only
Pancreatic carcinoma	Pancreatic carcinoma	BEFREE	16552335, 21728393		★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasm	Pancreatic Neoplasm	LHGDN	16552335		★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasms	Pancreatic neoplasm	Pubtator	23940715, 24341512	Associate	★☆☆☆☆ Found in Text Mining only
Pancytopenia	Pancytopenia	BEFREE	17164793, 21532034, 29976742		★☆☆☆☆ Found in Text Mining only
Pancytopenia	Pancytopenia	Pubtator	35572557	Associate	★☆☆☆☆ Found in Text Mining only
Papillary thyroid carcinoma	Papillary thyroid carcinoma	BEFREE	30019191		★☆☆☆☆ Found in Text Mining only
Papilloma	Papilloma	BEFREE	21670270		★☆☆☆☆ Found in Text Mining only
Paraganglioma	Paraganglioma	Pubtator	25794004	Associate	★☆☆☆☆ Found in Text Mining only
Parathyroid Neoplasms	Parathyroid neoplasm	Pubtator	19644013	Associate	★☆☆☆☆ Found in Text Mining only
Parkinson Disease	Parkinson disease	BEFREE	28196514		★☆☆☆☆ Found in Text Mining only
PARKINSON DISEASE, LATE-ONSET	Parkinson disease	BEFREE	28196514		★☆☆☆☆ Found in Text Mining only
Paroxysmal nocturnal hemoglobinuria	Paroxysmal nocturnal hemoglobinuria	BEFREE	10974022, 11530804, 12135676, 12411324, 12543108, 12668126, 17379072, 19013003, 23076633, 8652806, 9028939, 9238050		★☆☆☆☆ Found in Text Mining only
Paroxysmal nonkinesigenic dyskinesia	Paroxysmal nonkinesigenic dyskinesia	Pubtator	30614203	Associate	★☆☆☆☆ Found in Text Mining only
Perineurioma	Perineurioma	BEFREE	28035704		★☆☆☆☆ Found in Text Mining only
Periodontal Diseases	Periodontal Diseases	BEFREE	30656679		★☆☆☆☆ Found in Text Mining only
Peripheral Arterial Disease	Peripheral arterial disease	Pubtator	16456866	Associate	★☆☆☆☆ Found in Text Mining only
Peripheral Arterial Disease	Peripheral arterial disease	Pubtator	20570185	Inhibit	★☆☆☆☆ Found in Text Mining only
Peripheral Arterial Disease	Peripheral arterial disease	Pubtator	26324152	Stimulate	★☆☆☆☆ Found in Text Mining only
Peripheral Arterial Diseases	Vascular Diseases	BEFREE	21677770		★☆☆☆☆ Found in Text Mining only
Phyllodes Tumor	Phyllodes Tumor	BEFREE	11104647, 28029685		★☆☆☆☆ Found in Text Mining only
Pilocytic Astrocytoma	Astrocytoma	BEFREE	23442159		★☆☆☆☆ Found in Text Mining only
Pleomorphic Xanthoastrocytoma	Pleomorphic Xanthoastrocytoma	BEFREE	12624789, 24345274, 24857351, 30308344		★☆☆☆☆ Found in Text Mining only
Polycythemia Vera	Polycythemia Vera	BEFREE	10640993, 11882360, 12851693, 16133363, 16373657, 17256145, 17961178, 18515659, 18723264, 19004005, 19387466, 19815050, 20170959, 20601445, 20625010, 21527532, 22872685, 23341442, 23926298, 24869939, 25162887, 29851963, 9414643		★☆☆☆☆ Found in Text Mining only
Polycythemia Vera	Polycythemia vera	Pubtator	16603627, 20601445, 20625010, 22872685, 23265742, 23865766, 26275051, 31167802, 34921959	Associate	★☆☆☆☆ Found in Text Mining only
Polydactyly	Polydactyly	Pubtator	23771067	Associate	★☆☆☆☆ Found in Text Mining only
Porphyria Acute Intermittent	Porphyria	Pubtator	34326362	Associate	★☆☆☆☆ Found in Text Mining only
Porphyria Erythropoietic	Porphyria	Pubtator	11273784	Associate	★☆☆☆☆ Found in Text Mining only
Porphyria, Erythropoietic	Congenital erythropoietic porphyria	BEFREE	11273784		★☆☆☆☆ Found in Text Mining only
Pre B-cell acute lymphoblastic leukemia	B-cell Lymphoma	BEFREE	15257558, 16297978		★☆☆☆☆ Found in Text Mining only
Precursor B-cell lymphoblastic leukemia	Lymphoblastic Leukemia	BEFREE	10914546, 11001880, 16297978, 1696310, 20231472, 25793710, 8616034, 9692814		★☆☆☆☆ Found in Text Mining only
Precursor Cell Lymphoblastic Leukemia Lymphoma	Lymphoblastic Leukemia	LHGDN	12091359, 18683236		★☆☆☆☆ Found in Text Mining only
Precursor Cell Lymphoblastic Leukemia Lymphoma	Lymphoblastic Leukemia	BEFREE	15548716, 15580304, 1696310, 1713508, 17646667, 18683236, 19762535, 20498303, 25538041, 28691152, 30059823, 7536510, 9114595, 9305606		★☆☆☆☆ Found in Text Mining only
Precursor T-Cell Lymphoblastic Leukemia-Lymphoma	Lymphoblastic Leukemia	BEFREE	10891465, 17003368, 18683236, 20535151, 21968881, 22768113, 25344525, 27191650		★☆☆☆☆ Found in Text Mining only
Primary central nervous system lymphoma	Central Nervous System Lymphoma	BEFREE	31055591		★☆☆☆☆ Found in Text Mining only
Primary Myelofibrosis	Myelofibrosis	BEFREE	11721970, 15454487, 15471948, 15849170, 16879014, 16990584, 17875526, 18511598, 18515659, 18723264, 20858855, 22300941, 23445613, 24869939, 25097177, 25193869, 25236537, 25461253, 27114459, 27402956, 27582015, 28098757, 28745329, 31569199, 7536510, 7688180, 8977245		★☆☆☆☆ Found in Text Mining only
Primary Myelofibrosis	Myelofibrosis	LHGDN	18511598		★☆☆☆☆ Found in Text Mining only
Prostate cancer familial	Prostate cancer	Pubtator	30183767, 30328254	Associate	★☆☆☆☆ Found in Text Mining only
Prostate carcinoma	Prostate cancer	BEFREE	28730786		★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	15461859, 21180999, 28730786, 32962642	Associate	★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	16886625	Stimulate	★☆☆☆☆ Found in Text Mining only
Pruritus	Pruritus	Pubtator	19196660	Associate	★☆☆☆☆ Found in Text Mining only
Pseudohyperkalemia Cardiff	Pseudohyperkalemia Cardiff	BEFREE	25519836		★☆☆☆☆ Found in Text Mining only
Psoriasis	Psoriasis	BEFREE	26143958, 28238096		★☆☆☆☆ Found in Text Mining only
Psoriasis vulgaris	Psoriasis vulgaris	BEFREE	27520846		★☆☆☆☆ Found in Text Mining only
Psychotic Disorders	Psychosis	BEFREE	24246416		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Psychotic Disorders	Psychosis	PSYGENET_DG	24246416		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Pterygium	Pterygium	BEFREE	28087900, 28261971, 30713424		★☆☆☆☆ Found in Text Mining only
Pulmonary Arterial Hypertension	Pulmonary arterial hypertension	Pubtator	21258008, 23509326	Associate	★☆☆☆☆ Found in Text Mining only
Pulmonary Disease Chronic Obstructive	Chronic obstructive pulmonary disease	Pubtator	27784320	Associate	★☆☆☆☆ Found in Text Mining only
Pulmonary Emphysema	Pulmonary Emphysema	BEFREE	28291826		★☆☆☆☆ Found in Text Mining only
Quebec platelet disorder	Quebec Platelet Disorder	BEFREE	19029443		★☆☆☆☆ Found in Text Mining only
Refractory anaemia with excess blasts	Myelodysplastic syndrome	BEFREE	18637807, 21447369, 24850867, 7532058, 7539513, 9885439		★☆☆☆☆ Found in Text Mining only
Refractory anemia with ringed sideroblasts	Anemia With Ringed Sideroblasts	BEFREE	20633296, 23070040		★☆☆☆☆ Found in Text Mining only
Refractory anemias	Anemia	BEFREE	17360037, 18477045, 22315490, 8943864		★☆☆☆☆ Found in Text Mining only
Renal Cell Carcinoma	Renal Carcinoma	BEFREE	15095478, 31258725		★☆☆☆☆ Found in Text Mining only
Renal Insufficiency	Renal Insufficiency	BEFREE	29980767		★☆☆☆☆ Found in Text Mining only
Respiratory Tract Infections	Respiratory system infectious disease	Pubtator	22977664	Associate	★☆☆☆☆ Found in Text Mining only
Retinal Detachment	Retinal Detachment	BEFREE	31185026		★☆☆☆☆ Found in Text Mining only
Retinal Diseases	Retinal Diseases	BEFREE	25221423, 27352134		★☆☆☆☆ Found in Text Mining only
Rheumatoid Arthritis	Rheumatoid arthritis	BEFREE	15248213, 17360037, 18383391, 20346245, 26546613, 29476097, 31017736		★☆☆☆☆ Found in Text Mining only
Rhinitis Allergic Seasonal	Seasonal allergic rhinitis	Pubtator	15627640	Associate	★☆☆☆☆ Found in Text Mining only
Sarcoma	Sarcoma	Pubtator	12946229, 24072183, 25759557, 32957984	Associate	★☆☆☆☆ Found in Text Mining only
Sarcoma	Sarcoma	LHGDN	16557578		★☆☆☆☆ Found in Text Mining only
Sarcoma	Sarcoma	BEFREE	19036083, 21666577, 30520818, 30877273		★☆☆☆☆ Found in Text Mining only
Sarcoma Ewing	Sarcoma	Pubtator	24498265	Associate	★☆☆☆☆ Found in Text Mining only
Sarcoma Kaposi	Sarcoma	Pubtator	23936513, 26125890	Associate	★☆☆☆☆ Found in Text Mining only
Sarcoma, Epithelioid	Sarcoma	BEFREE	19125742, 19342946, 26645461, 30291790		★☆☆☆☆ Found in Text Mining only
Scleroderma	Scleroderma	BEFREE	29298160, 30320623		★☆☆☆☆ Found in Text Mining only
Scleroderma Diffuse	Scleroderma	Pubtator	33028580	Associate	★☆☆☆☆ Found in Text Mining only
secondary acute myeloid leukemia	Myeloid leukemia	BEFREE	19148132, 22197676, 22419576, 23604035, 28133783, 8895688, 9196139		★☆☆☆☆ Found in Text Mining only
Seminoma	Seminoma	BEFREE	31540712		★☆☆☆☆ Found in Text Mining only
Septicemia	Septicemia	BEFREE	29601599		★☆☆☆☆ Found in Text Mining only
Severe Aplastic Anemia	Anemia	BEFREE	18637807, 22315490, 24938700		★☆☆☆☆ Found in Text Mining only
Severe Combined Immunodeficiency	Severe combined immunodeficiency disease	BEFREE	10942359, 14564000, 17053889, 19420076, 20201651, 20724541, 22551777, 22569301, 22968453, 23777766, 26441229, 27938494, 29875383, 31569199, 7691188		★☆☆☆☆ Found in Text Mining only
Severe Combined Immunodeficiency	Severe combined immunodeficiency	Pubtator	17923243, 18804042, 36546626, 8704221	Associate	★☆☆☆☆ Found in Text Mining only
Severe Combined Immunodeficiency	Severe combined immunodeficiency	Pubtator	25143186	Inhibit	★☆☆☆☆ Found in Text Mining only
Severe combined immunodeficiency due to adenosine deaminase deficiency	Severe combined immunodeficiency disease	BEFREE	15564141, 19179314, 19652199, 7691188, 8704221, 8867866		★☆☆☆☆ Found in Text Mining only
Severe combined immunodeficiency due to adenosine deaminase deficiency	Severe combined immunodeficiency	Pubtator	34184208, 38355973	Associate	★☆☆☆☆ Found in Text Mining only
Skin Diseases	Skin disease	Pubtator	21338206	Associate	★☆☆☆☆ Found in Text Mining only
Skin lesion	Skin Lesion	BEFREE	11505412		★☆☆☆☆ Found in Text Mining only
Skin Neoplasms	Skin Neoplasms	BEFREE	19125742, 21670270, 30187166		★☆☆☆☆ Found in Text Mining only
Sleep Apnea Obstructive	Sleep apnea	Pubtator	31113468	Inhibit	★☆☆☆☆ Found in Text Mining only
Sleep Apnea Obstructive	Sleep apnea	Pubtator	32020899	Stimulate	★☆☆☆☆ Found in Text Mining only
Sleep Apnea Syndromes	Sleep Apnea	BEFREE	31113468		★☆☆☆☆ Found in Text Mining only
Sleep Apnea, Obstructive	Sleep Apnea	BEFREE	31113468		★☆☆☆☆ Found in Text Mining only
Soft Tissue Neoplasms	Soft Tissue Neoplasms	BEFREE	30187166, 7681857		★☆☆☆☆ Found in Text Mining only
Solitary fibrous tumor	Solitary fibrous tumor	BEFREE	10574600, 11306891, 18262056, 19718788, 20527023, 22586056, 22613995, 24807787, 25416841, 25667482, 26226844, 28683839, 29309807, 29438169, 29780261, 29940288, 30031100		★☆☆☆☆ Found in Text Mining only
Somatotropin deficiency	Somatotropin Deficiency	BEFREE	28067847		★☆☆☆☆ Found in Text Mining only
Splenomegaly	Splenomegaly	Pubtator	36550645	Associate	★☆☆☆☆ Found in Text Mining only
Spondylo-ocular syndrome	Spondyloocular Syndrome	BEFREE	28061766		★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma	Carcinoma	BEFREE	14708636, 17310847, 21670270, 9815891		★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma	Carcinoma	LHGDN	17310847		★☆☆☆☆ Found in Text Mining only
Squamous Cell Carcinoma of Head and Neck	Squamous cell carcinoma	Pubtator	14648070, 17378915, 26722595, 33383808, 39873996	Associate	★☆☆☆☆ Found in Text Mining only
Squamous Cell Carcinoma of Head and Neck	Squamous cell carcinoma	Pubtator	29748768	Stimulate	★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of the head and neck	Carcinoma Of The Head And Neck	BEFREE	17310847, 27837456, 28314285, 29748768		★☆☆☆☆ Found in Text Mining only
Steatohepatitis	Fatty Liver	BEFREE	30259536		★☆☆☆☆ Found in Text Mining only
Stomach Carcinoma	Stomach Carcinoma	BEFREE	11458276, 18200665, 20383661, 28574630, 29881296, 30292405, 31702632		★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	11458276, 11684718, 15040021, 20593045, 24083700, 27503021, 34876056	Associate	★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach Neoplasms	BEFREE	15224284		★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach Neoplasms	LHGDN	18555590		★☆☆☆☆ Found in Text Mining only
Strawberry nevus of skin	Strawberry Nevus Of Skin	BEFREE	20870476, 31091531		★☆☆☆☆ Found in Text Mining only
Sweet Syndrome	Sweet Syndrome	BEFREE	11168757		★☆☆☆☆ Found in Text Mining only
synovial sarcoma	Synovial sarcoma	BEFREE	12409719, 23287123, 24252471, 26970672, 28761985		★☆☆☆☆ Found in Text Mining only
Systemic Scleroderma	Scleroderma	BEFREE	26807760, 29298160, 30320623, 30670057		★☆☆☆☆ Found in Text Mining only
Telangiectasia Hereditary Hemorrhagic	Hereditary hemorrhagic telangiectasia	Pubtator	24587130	Stimulate	★☆☆☆☆ Found in Text Mining only
Teratoma	Teratoma	BEFREE	9191534		★☆☆☆☆ Found in Text Mining only
Thalassemia	Thalassemia	Pubtator	10089916, 36560719	Associate	★☆☆☆☆ Found in Text Mining only
Thrombasthenia	Thrombasthenia	BEFREE	10845892		★☆☆☆☆ Found in Text Mining only
Thrombocythemia Essential	Essential thrombocythemia	Pubtator	23865766, 31801935, 37550636	Associate	★☆☆☆☆ Found in Text Mining only
Thrombocythemia, Essential	Thrombocythemia	BEFREE	10621836, 12200693, 15271793, 15477204, 17875526, 17952438, 18723264, 21074499, 22300941, 31801935		★☆☆☆☆ Found in Text Mining only
Thrombocytopenia	Thrombocytopenia	Pubtator	11823041, 1375110, 28880435, 7540888	Associate	★☆☆☆☆ Found in Text Mining only
THROMBOCYTOPENIA 1 (disorder)	Thrombocytopenia	BEFREE	10397718, 10583210		★☆☆☆☆ Found in Text Mining only
Thrombocytopenia Platelet Dysfunction Hemolysis and Imbalanced Globin Synthesis	Thrombocytopenia	Pubtator	25421114	Associate	★☆☆☆☆ Found in Text Mining only
Thrombocytosis	Thrombocytosis	Pubtator	18723264, 35381074	Associate	★☆☆☆☆ Found in Text Mining only
Thrombosis	Thrombosis	Pubtator	31263845, 31801935	Associate	★☆☆☆☆ Found in Text Mining only
Thyroid associated opthalmopathies	Thyroid eye disease	BEFREE	23633206, 24708100, 26287404, 29847667, 29847668, 30445529		★☆☆☆☆ Found in Text Mining only
Thyroid Cancer Papillary	Papillary thyroid cancer	Pubtator	15962085, 34325712	Associate	★☆☆☆☆ Found in Text Mining only
Thyroid carcinoma	Thyroid Carcinoma	BEFREE	27577959		★☆☆☆☆ Found in Text Mining only
Thyroid Diseases	Thyroid Diseases	BEFREE	19903799		★☆☆☆☆ Found in Text Mining only
Thyroid Neoplasm	Thyroid Neoplasm	BEFREE	27577959		★☆☆☆☆ Found in Text Mining only
Thyroiditis	Thyroiditis	Pubtator	34717558	Associate	★☆☆☆☆ Found in Text Mining only
Tourette Syndrome	Tourette syndrome	Pubtator	28067847	Inhibit	★☆☆☆☆ Found in Text Mining only
Trichilemmoma	Trichilemmoma	BEFREE	29570129		★☆☆☆☆ Found in Text Mining only
Trichohepatoenteric Syndrome	Trichohepatoenteric Syndrome	BEFREE	17570514		★☆☆☆☆ Found in Text Mining only
Triple Negative Breast Neoplasms	Triple negative breast cancer	Pubtator	34489506, 37077065	Associate	★☆☆☆☆ Found in Text Mining only
Ulcerative Colitis	Ulcerative colitis	BEFREE	17459027, 19067429		★☆☆☆☆ Found in Text Mining only
Unipolar Depression	Mental Depression	PSYGENET_DG	18180758		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Urinary Bladder Diseases	Urinary bladder diseases	Pubtator	21251216	Associate	★☆☆☆☆ Found in Text Mining only
Uterine Cervical Dysplasia	Uterine disease	Pubtator	19383239	Associate	★☆☆☆☆ Found in Text Mining only
Uterine Cervical Neoplasms	Uterine neoplasm	Pubtator	20495745, 33392721, 35264072	Associate	★☆☆☆☆ Found in Text Mining only
Uterine Diseases	Uterine polyp	Pubtator	26769301	Associate	★☆☆☆☆ Found in Text Mining only
Uterine Fibroids	Uterine Fibroids	BEFREE	25658015, 28067672, 30168888		★☆☆☆☆ Found in Text Mining only
Vascular Calcification	Vascular calcification	Pubtator	34833374	Associate	★☆☆☆☆ Found in Text Mining only
Vascular Diseases	Vascular disease	Pubtator	19657392	Associate	★☆☆☆☆ Found in Text Mining only
Vascular Diseases	Vascular Diseases	BEFREE	31746407		★☆☆☆☆ Found in Text Mining only
Vascular System Injuries	Vascular system injury	Pubtator	23951234	Inhibit	★☆☆☆☆ Found in Text Mining only
Vasculitis Leukocytoclastic Cutaneous	Vasculitis	Pubtator	28639855	Associate	★☆☆☆☆ Found in Text Mining only
Ventricular arrhythmia	Ventricular arrhythmia	BEFREE	31046425		★☆☆☆☆ Found in Text Mining only
Ventricular Dysfunction Left	Ventricular dysfunction	Pubtator	24102302	Stimulate	★☆☆☆☆ Found in Text Mining only
Vesicoureteral Reflux 1	Vesicoureteral Reflux	BEFREE	30178448		★☆☆☆☆ Found in Text Mining only
Well Differentiated Oligodendroglioma	Oligodendroglioma	BEFREE	27812792		★☆☆☆☆ Found in Text Mining only
Wilms Tumor	Wilms tumor	Pubtator	11841446	Associate	★☆☆☆☆ Found in Text Mining only
Wiskott-Aldrich Syndrome	Wiskott-Aldrich Syndrome	BEFREE	10583210, 21043787, 25518736		★☆☆☆☆ Found in Text Mining only
X-Linked Combined Immunodeficiency Diseases	Combined Immunodeficiency, X-Linked	BEFREE	11961146, 12070011, 12174674, 14564000, 15701981, 18688285, 19277017, 20457870, 22551777, 9834214		★☆☆☆☆ Found in Text Mining only
Xanthomatosis Cerebrotendinous	Xanthomatosis	Pubtator	2478216	Stimulate	★☆☆☆☆ Found in Text Mining only