Gene Gene information from NCBI Gene database.
Entrez ID 947
Gene name CD34 molecule
Gene symbol CD34
Synonyms (NCBI Gene)
-
Chromosome 1
Chromosome location 1q32.2
Summary The protein encoded by this gene may play a role in the attachment of stem cells to the bone marrow extracellular matrix or to stromal cells. This single-pass membrane protein is highly glycosylated and phosphorylated by protein kinase C. Two transcript v
miRNA miRNA information provided by mirtarbase database.
80
miRTarBase ID miRNA Experiments Reference
MIRT004052 hsa-miR-125a-5p Luciferase reporter assayMicroarrayWestern blot 18308931
MIRT020428 hsa-miR-106b-5p Microarray 17242205
MIRT004052 hsa-miR-125a-5p Reporter assay;Western blot 18308931
MIRT021486 hsa-miR-9-5p Western blot 18308931
MIRT030549 hsa-miR-24-3p qRT-PCR 19748357
Transcription factors Transcription factors information provided by TRRUST V2 database.
4
Transcription factor Regulation Reference
MYB Unknown 7523384
MZF1 Unknown 8585946
RUNX1 Activation 21873977
TAL1 Repression 14715640
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
51
GO ID Ontology Definition Evidence Reference
GO:0001894 Process Tissue homeostasis IDA 12939361
GO:0001935 Process Endothelial cell proliferation IDA 21835908
GO:0003094 Process Glomerular filtration IEP 20354148
GO:0003158 Process Endothelium development IEP 17261663
GO:0005515 Function Protein binding IPI 32296183
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
MIM HGNC e!Ensembl
142230 1662 ENSG00000174059
Protein Protein information from UniProt database.
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
P28906
Protein name Hematopoietic progenitor cell antigen CD34 (CD antigen CD34)
Protein function Possible adhesion molecule with a role in early hematopoiesis by mediating the attachment of stem cells to the bone marrow extracellular matrix or directly to stromal cells. Could act as a scaffold for the attachment of lineage specific glycans,
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF06365 CD34_antigen 190 385 CD34/Podocalyxin family Family
Tissue specificity TISSUE SPECIFICITY: Selectively expressed on hematopoietic progenitor cells and the small vessel endothelium of a variety of tissues.
Sequence
MLVRRGARAGPRMPRGWTALCLLSLLPSGFMSLDNNGTATPELPTQGTFSNVSTNVSYQE
TTTPSTLGSTSLHPVSQHGNEATTNITETTVKFTSTSVITSVYGNTNSSVQSQTSVISTV
FTTPANVSTPETTLKPSLSPGNVSDLSTTSTSLATSPTKPYTSSSPILSDIKAEIKCSGI
REVKLTQGICLEQNKTSSCAEFKKDRGEGLARVLCGEEQADADAGAQVCSLLLAQSEVRP
QCLLLVLANRTEISSKLQLMKKHQSDLKKLGILDFTEQDVASHQSYSQKTLIALVTSGAL
LAVLGITGYFLMNRRSWSPTGERLGEDPYYTENGGGQGYSSGPGTSPEAQGKASVNRGAQ
ENGTGQATSRNGHSARQHVVADTEL
Sequence length 385
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  KEGG  Reactome
  Cell adhesion molecules
Hematopoietic cell lineage
  Immunoregulatory interactions between a Lymphoid and a non-Lymphoid cell
Associated diseases Disease associations from ClinVar (causal & non-causal) and other databases (OMIM, Orphanet, GWAS, etc.).
8
Evidence Score: ★☆☆☆☆  Gene-disease association found in Text Mining only ★★☆☆☆  Found in Text Mining and Unknown/Other Associations ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
Phenotype Name Clinical Significance Source Evidence Score
ALZHEIMER DISEASE GWAS catalog
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
BREAST CANCER GWAS catalog
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
BREAST CARCINOMA GWAS catalog
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
CARCINOMA, HEPATOCELLULAR CTD
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
Associations from Text Mining Disease associations identified through text mining
Disease Name Disease (Merged) Source PMID Relationship Type Evidence Score
5q-syndrome 5q-syndrome BEFREE 18477045
★☆☆☆☆
Found in Text Mining only
Abetalipoproteinemia Abetalipoproteinemia BEFREE 12855552
★☆☆☆☆
Found in Text Mining only
Acute Coronary Syndrome Coronary Syndrome BEFREE 28060837
★☆☆☆☆
Found in Text Mining only
Acute Erythroblastic Leukemia Erythroblastic Leukemia BEFREE 23180570
★☆☆☆☆
Found in Text Mining only
Acute leukemia Leukemia BEFREE 12853345, 12953810, 15471948, 1705862, 18702870, 18803279, 20376583, 2459568, 27595757, 7540889, 8528052
★☆☆☆☆
Found in Text Mining only
Acute lymphocytic leukemia Lymphocytic Leukemia BEFREE 10477734, 11531016, 1548523, 15548716, 15580304, 16029452, 16643437, 1696310, 16979235, 17041637, 1713508, 17646667, 17717597, 18683236, 19762535
View all (16 more)
★☆☆☆☆
Found in Text Mining only
Acute monocytic leukemia Monocytic Leukemia BEFREE 10721774, 11168757, 12008077, 20232575, 20505189, 21135860, 21739277, 21760593, 22258035, 22289983, 22898323, 23604035, 25990244, 27065320, 30352278
View all (2 more)
★☆☆☆☆
Found in Text Mining only
Acute Myeloid Leukemia, M1 Myeloid Leukemia BEFREE 2646903
★☆☆☆☆
Found in Text Mining only
Acute myeloid leukemia, minimal differentiation Myeloid Leukemia BEFREE 22162288, 9002966
★☆☆☆☆
Found in Text Mining only
Acute myelomonocytic leukemia Myelomonocytic Leukemia BEFREE 25241285
★☆☆☆☆
Found in Text Mining only