Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	9468
Gene name	Phosphate cytidylyltransferase 1B, choline
Gene symbol	PCYT1B
Synonyms (NCBI Gene)	CCTBCTB
Chromosome	X
Chromosome location	Xp22.11
Summary	The protein encoded by this gene belongs to the cytidylyltransferase family. It is involved in the regulation of phosphatidylcholine biosynthesis. Several alternatively spliced transcript variants encoding different isoforms have been found for this gene.

218

Show/Hide all (218)

miRTarBase ID	miRNA	Experiments	Reference
MIRT032240	hsa-let-7b-5p	Proteomics	18668040
MIRT713405	hsa-miR-6741-3p	HITS-CLIP	19536157
MIRT713405	hsa-miR-6741-3p	HITS-CLIP	19536157
MIRT1218864	hsa-miR-105	CLIP-seq
MIRT1218865	hsa-miR-1207-3p	CLIP-seq
MIRT1218866	hsa-miR-1227	CLIP-seq
MIRT1218867	hsa-miR-1238	CLIP-seq
MIRT1218868	hsa-miR-125a-3p	CLIP-seq
MIRT1218869	hsa-miR-1273d	CLIP-seq
MIRT1218870	hsa-miR-1286	CLIP-seq
MIRT1218871	hsa-miR-135a	CLIP-seq
MIRT1218872	hsa-miR-135b	CLIP-seq
MIRT1218873	hsa-miR-1470	CLIP-seq
MIRT1218874	hsa-miR-185	CLIP-seq
MIRT1218875	hsa-miR-192	CLIP-seq
MIRT1218876	hsa-miR-193a-3p	CLIP-seq
MIRT1218877	hsa-miR-193b	CLIP-seq
MIRT1218878	hsa-miR-214	CLIP-seq
MIRT1218879	hsa-miR-215	CLIP-seq
MIRT1218880	hsa-miR-2278	CLIP-seq
MIRT1218881	hsa-miR-2355-3p	CLIP-seq
MIRT1218882	hsa-miR-25	CLIP-seq
MIRT1218883	hsa-miR-2682	CLIP-seq
MIRT1218884	hsa-miR-298	CLIP-seq
MIRT1218885	hsa-miR-3119	CLIP-seq
MIRT1218886	hsa-miR-3124-3p	CLIP-seq
MIRT1218887	hsa-miR-3165	CLIP-seq
MIRT1218888	hsa-miR-3190	CLIP-seq
MIRT1218889	hsa-miR-3192	CLIP-seq
MIRT1218890	hsa-miR-32	CLIP-seq
MIRT1218891	hsa-miR-3202	CLIP-seq
MIRT1218892	hsa-miR-330-3p	CLIP-seq
MIRT1218893	hsa-miR-335	CLIP-seq
MIRT1218894	hsa-miR-338-5p	CLIP-seq
MIRT1218895	hsa-miR-3612	CLIP-seq
MIRT1218896	hsa-miR-3619-5p	CLIP-seq
MIRT1218897	hsa-miR-363	CLIP-seq
MIRT1218898	hsa-miR-3661	CLIP-seq
MIRT1218899	hsa-miR-367	CLIP-seq
MIRT1218900	hsa-miR-3672	CLIP-seq
MIRT1218901	hsa-miR-3689a-3p	CLIP-seq
MIRT1218902	hsa-miR-3689c	CLIP-seq
MIRT1218903	hsa-miR-3689d	CLIP-seq
MIRT1218904	hsa-miR-3690	CLIP-seq
MIRT1218905	hsa-miR-3926	CLIP-seq
MIRT1218906	hsa-miR-3974	CLIP-seq
MIRT1218907	hsa-miR-3977	CLIP-seq
MIRT1218908	hsa-miR-4291	CLIP-seq
MIRT1218909	hsa-miR-4292	CLIP-seq
MIRT1218910	hsa-miR-4306	CLIP-seq
MIRT1218911	hsa-miR-4308	CLIP-seq
MIRT1218912	hsa-miR-4312	CLIP-seq
MIRT1218913	hsa-miR-4325	CLIP-seq
MIRT1218914	hsa-miR-4437	CLIP-seq
MIRT1218915	hsa-miR-4443	CLIP-seq
MIRT1218916	hsa-miR-4468	CLIP-seq
MIRT1218917	hsa-miR-4469	CLIP-seq
MIRT1218918	hsa-miR-4492	CLIP-seq
MIRT1218919	hsa-miR-4498	CLIP-seq
MIRT1218920	hsa-miR-4499	CLIP-seq
MIRT1218921	hsa-miR-449c	CLIP-seq
MIRT1218922	hsa-miR-4505	CLIP-seq
MIRT1218923	hsa-miR-4520a-3p	CLIP-seq
MIRT1218924	hsa-miR-4520b-3p	CLIP-seq
MIRT1218925	hsa-miR-4529-3p	CLIP-seq
MIRT1218926	hsa-miR-4533	CLIP-seq
MIRT1218927	hsa-miR-4537	CLIP-seq
MIRT1218928	hsa-miR-4638-3p	CLIP-seq
MIRT1218929	hsa-miR-4644	CLIP-seq
MIRT1218930	hsa-miR-4646-3p	CLIP-seq
MIRT1218931	hsa-miR-4652-5p	CLIP-seq
MIRT1218932	hsa-miR-4663	CLIP-seq
MIRT1218933	hsa-miR-4666-3p	CLIP-seq
MIRT1218934	hsa-miR-4667-3p	CLIP-seq
MIRT1218935	hsa-miR-4676-5p	CLIP-seq
MIRT1218936	hsa-miR-4684-5p	CLIP-seq
MIRT1218937	hsa-miR-4686	CLIP-seq
MIRT1218938	hsa-miR-4688	CLIP-seq
MIRT1218939	hsa-miR-4691-5p	CLIP-seq
MIRT1218940	hsa-miR-4712-3p	CLIP-seq
MIRT1218941	hsa-miR-4720-5p	CLIP-seq
MIRT1218942	hsa-miR-4728-5p	CLIP-seq
MIRT1218943	hsa-miR-4771	CLIP-seq
MIRT1218944	hsa-miR-4786-5p	CLIP-seq
MIRT1218945	hsa-miR-4799-3p	CLIP-seq
MIRT1218946	hsa-miR-483-5p	CLIP-seq
MIRT1218947	hsa-miR-485-5p	CLIP-seq
MIRT1218948	hsa-miR-490-3p	CLIP-seq
MIRT1218949	hsa-miR-499a-5p	CLIP-seq
MIRT1218950	hsa-miR-512-5p	CLIP-seq
MIRT1218951	hsa-miR-522	CLIP-seq
MIRT1218952	hsa-miR-548s	CLIP-seq
MIRT1218953	hsa-miR-549	CLIP-seq
MIRT1218954	hsa-miR-552	CLIP-seq
MIRT1218955	hsa-miR-575	CLIP-seq
MIRT1218956	hsa-miR-631	CLIP-seq
MIRT1218957	hsa-miR-642b	CLIP-seq
MIRT1218958	hsa-miR-650	CLIP-seq
MIRT1218959	hsa-miR-659	CLIP-seq
MIRT1218960	hsa-miR-660	CLIP-seq
MIRT1218961	hsa-miR-761	CLIP-seq
MIRT1218962	hsa-miR-762	CLIP-seq
MIRT1218963	hsa-miR-767-3p	CLIP-seq
MIRT1218964	hsa-miR-769-5p	CLIP-seq
MIRT1218965	hsa-miR-873	CLIP-seq
MIRT1218966	hsa-miR-888	CLIP-seq
MIRT1218967	hsa-miR-892b	CLIP-seq
MIRT1218968	hsa-miR-922	CLIP-seq
MIRT1218969	hsa-miR-92a	CLIP-seq
MIRT1218970	hsa-miR-92b	CLIP-seq
MIRT1218971	hsa-miR-940	CLIP-seq
MIRT2063331	hsa-miR-1207-5p	CLIP-seq
MIRT2063332	hsa-miR-1245b-5p	CLIP-seq
MIRT1218871	hsa-miR-135a	CLIP-seq
MIRT1218872	hsa-miR-135b	CLIP-seq
MIRT1218874	hsa-miR-185	CLIP-seq
MIRT1218875	hsa-miR-192	CLIP-seq
MIRT2063333	hsa-miR-205	CLIP-seq
MIRT1218879	hsa-miR-215	CLIP-seq
MIRT2063334	hsa-miR-3064-3p	CLIP-seq
MIRT2063335	hsa-miR-3134	CLIP-seq
MIRT2063336	hsa-miR-3142	CLIP-seq
MIRT1218889	hsa-miR-3192	CLIP-seq
MIRT1218895	hsa-miR-3612	CLIP-seq
MIRT1218898	hsa-miR-3661	CLIP-seq
MIRT2063337	hsa-miR-3667-3p	CLIP-seq
MIRT1218900	hsa-miR-3672	CLIP-seq
MIRT1218901	hsa-miR-3689a-3p	CLIP-seq
MIRT1218902	hsa-miR-3689c	CLIP-seq
MIRT1218903	hsa-miR-3689d	CLIP-seq
MIRT1218905	hsa-miR-3926	CLIP-seq
MIRT2063338	hsa-miR-412	CLIP-seq
MIRT2063339	hsa-miR-4297	CLIP-seq
MIRT1218910	hsa-miR-4306	CLIP-seq
MIRT1218915	hsa-miR-4443	CLIP-seq
MIRT1218920	hsa-miR-4499	CLIP-seq
MIRT2063340	hsa-miR-4534	CLIP-seq
MIRT1218927	hsa-miR-4537	CLIP-seq
MIRT2063341	hsa-miR-4633-5p	CLIP-seq
MIRT1218929	hsa-miR-4644	CLIP-seq
MIRT1218932	hsa-miR-4663	CLIP-seq
MIRT1218942	hsa-miR-4728-5p	CLIP-seq
MIRT2063342	hsa-miR-4763-3p	CLIP-seq
MIRT1218944	hsa-miR-4786-5p	CLIP-seq
MIRT2063343	hsa-miR-4793-5p	CLIP-seq
MIRT1218947	hsa-miR-485-5p	CLIP-seq
MIRT2063344	hsa-miR-526b	CLIP-seq
MIRT2063345	hsa-miR-532-5p	CLIP-seq
MIRT1218952	hsa-miR-548s	CLIP-seq
MIRT1218956	hsa-miR-631	CLIP-seq
MIRT1218958	hsa-miR-650	CLIP-seq
MIRT1218959	hsa-miR-659	CLIP-seq
MIRT2063346	hsa-miR-7	CLIP-seq
MIRT1218964	hsa-miR-769-5p	CLIP-seq
MIRT2063347	hsa-miR-890	CLIP-seq
MIRT2063348	hsa-miR-924	CLIP-seq
MIRT1218866	hsa-miR-1227	CLIP-seq
MIRT1218884	hsa-miR-298	CLIP-seq
MIRT2392236	hsa-miR-1291	CLIP-seq
MIRT1218875	hsa-miR-192	CLIP-seq
MIRT1218879	hsa-miR-215	CLIP-seq
MIRT2392237	hsa-miR-299-5p	CLIP-seq
MIRT2063334	hsa-miR-3064-3p	CLIP-seq
MIRT2392238	hsa-miR-328	CLIP-seq
MIRT1218898	hsa-miR-3661	CLIP-seq
MIRT2392239	hsa-miR-370	CLIP-seq
MIRT2063341	hsa-miR-4633-5p	CLIP-seq
MIRT2063345	hsa-miR-532-5p	CLIP-seq
MIRT1218954	hsa-miR-552	CLIP-seq
MIRT1218956	hsa-miR-631	CLIP-seq
MIRT1218959	hsa-miR-659	CLIP-seq
MIRT2392240	hsa-miR-876-3p	CLIP-seq
MIRT2063347	hsa-miR-890	CLIP-seq
MIRT2456030	hsa-miR-1323	CLIP-seq
MIRT1218882	hsa-miR-25	CLIP-seq
MIRT1218890	hsa-miR-32	CLIP-seq
MIRT1218893	hsa-miR-335	CLIP-seq
MIRT2456031	hsa-miR-3613-3p	CLIP-seq
MIRT1218897	hsa-miR-363	CLIP-seq
MIRT1218899	hsa-miR-367	CLIP-seq
MIRT2456032	hsa-miR-371-5p	CLIP-seq
MIRT2456033	hsa-miR-371b-5p	CLIP-seq
MIRT2456034	hsa-miR-4293	CLIP-seq
MIRT1218913	hsa-miR-4325	CLIP-seq
MIRT1218936	hsa-miR-4684-5p	CLIP-seq
MIRT2456035	hsa-miR-508-5p	CLIP-seq
MIRT2456036	hsa-miR-548o	CLIP-seq
MIRT2456037	hsa-miR-548p	CLIP-seq
MIRT2456038	hsa-miR-766	CLIP-seq
MIRT1218969	hsa-miR-92a	CLIP-seq
MIRT1218970	hsa-miR-92b	CLIP-seq
MIRT2456030	hsa-miR-1323	CLIP-seq
MIRT2589458	hsa-miR-3122	CLIP-seq
MIRT2589459	hsa-miR-3173-3p	CLIP-seq
MIRT2456031	hsa-miR-3613-3p	CLIP-seq
MIRT1218901	hsa-miR-3689a-3p	CLIP-seq
MIRT1218902	hsa-miR-3689c	CLIP-seq
MIRT2456032	hsa-miR-371-5p	CLIP-seq
MIRT2456033	hsa-miR-371b-5p	CLIP-seq
MIRT2589460	hsa-miR-3913-5p	CLIP-seq
MIRT2456034	hsa-miR-4293	CLIP-seq
MIRT1218913	hsa-miR-4325	CLIP-seq
MIRT2589461	hsa-miR-4428	CLIP-seq
MIRT2589462	hsa-miR-4434	CLIP-seq
MIRT2589463	hsa-miR-4477b	CLIP-seq
MIRT2589464	hsa-miR-4516	CLIP-seq
MIRT1218936	hsa-miR-4684-5p	CLIP-seq
MIRT1218942	hsa-miR-4728-5p	CLIP-seq
MIRT2589465	hsa-miR-501-5p	CLIP-seq
MIRT2456035	hsa-miR-508-5p	CLIP-seq
MIRT2456036	hsa-miR-548o	CLIP-seq
MIRT2456038	hsa-miR-766	CLIP-seq
MIRT2589458	hsa-miR-3122	CLIP-seq
MIRT1218901	hsa-miR-3689a-3p	CLIP-seq
MIRT1218902	hsa-miR-3689c	CLIP-seq
MIRT2589460	hsa-miR-3913-5p	CLIP-seq
MIRT1218936	hsa-miR-4684-5p	CLIP-seq
MIRT1218942	hsa-miR-4728-5p	CLIP-seq

Show/Hide all (26)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001541	Process	Ovarian follicle development	IEA
GO:0003824	Function	Catalytic activity	IEA
GO:0004105	Function	Choline-phosphate cytidylyltransferase activity	IBA
GO:0004105	Function	Choline-phosphate cytidylyltransferase activity	IDA	10480912
GO:0004105	Function	Choline-phosphate cytidylyltransferase activity	IEA
GO:0004105	Function	Choline-phosphate cytidylyltransferase activity	TAS	9593753
GO:0005515	Function	Protein binding	IPI	32296183
GO:0005737	Component	Cytoplasm	IEA
GO:0005737	Component	Cytoplasm	TAS	9593753
GO:0005783	Component	Endoplasmic reticulum	IDA	10480912
GO:0005783	Component	Endoplasmic reticulum	IEA
GO:0005789	Component	Endoplasmic reticulum membrane	TAS
GO:0006629	Process	Lipid metabolic process	IEA
GO:0006656	Process	Phosphatidylcholine biosynthetic process	IDA	10480912
GO:0006656	Process	Phosphatidylcholine biosynthetic process	IEA
GO:0006656	Process	Phosphatidylcholine biosynthetic process	TAS	9593753
GO:0006657	Process	CDP-choline pathway	IDA	10480912
GO:0006657	Process	CDP-choline pathway	IEA
GO:0007283	Process	Spermatogenesis	IEA
GO:0008654	Process	Phospholipid biosynthetic process	IEA
GO:0016740	Function	Transferase activity	IEA
GO:0016779	Function	Nucleotidyltransferase activity	IEA
GO:0031210	Function	Phosphatidylcholine binding	IBA
GO:0042802	Function	Identical protein binding	IPI	32296183
GO:0046470	Process	Phosphatidylcholine metabolic process	IEA
GO:0090407	Process	Organophosphate biosynthetic process	IEA

MIM	HGNC	e!Ensembl
300948	8755	ENSG00000102230

Q9Y5K3

Protein name

Choline-phosphate cytidylyltransferase B (EC 2.7.7.15) (CCT-beta) (CTP:phosphocholine cytidylyltransferase B) (CCT B) (CT B) (Phosphorylcholine transferase B)

Protein function

[Isoform 1]: Catalyzes the key rate-limiting step in the CDP-choline pathway for phosphatidylcholine biosynthesis. ; [Isoform 2]: Catalyzes the key rate-limiting step in the CDP

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF01467	CTP_transf_like	80 → 208	Cytidylyltransferase-like	Domain

Tissue specificity

TISSUE SPECIFICITY: [Isoform 1]: Highly expressed in testis, placenta, brain, ovary, liver and fetal lung. {ECO:0000269|PubMed:10480912, ECO:0000269|PubMed:9593753}.; TISSUE SPECIFICITY: [Isoform 2]: Expressed in brain, liver and fetal lung. {ECO:0000269|

Sequence

MPVVTTDAESETGIPKSLSNEPPSETMEEIEHTCPQPRLTLTAPAPFADETNCQCQAPHE
KLTIAQARLGTPADRPVRVYADGIFDLFHSGHARALMQAKTLFPNSYLLVGVCSDDLTHK
FKGFTVMNEAERYEALRHCRYVDEVIRDAPWTLTPEFLEKHKIDFVAHDDIPYSSAGSDD
VYKHIKEAGMFVPTQRTEGISTSDIITRIVRDYDVYARRNLQRGYTAKELNVSFINEKRY
RFQNQVDKMKEKVKNVEERSKEFVNRVEEKSHDLIQKWEEKSREFIGNFLELFGPDGAWK
QMFQERSSRMLQALSPKQSPVSSPTRSRSPSRSPSPTFSWLPLKTSPPSSPKAASASISS
MSEGDEDEK

Sequence length

369

Interactions

View interactions

	KEGG		Reactome
	Phosphonate and phosphinate metabolism Glycerophospholipid metabolism Metabolic pathways Choline metabolism in cancer		Synthesis of PC

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (6)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
ARTHRITIS, JUVENILE	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
INSOMNIA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
JUVENILE CHRONIC POLYARTHRITIS	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MONOARTICULAR JUVENILE RHEUMATOID ARTHRITIS	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PAUCIARTICULAR JUVENILE RHEUMATOID ARTHRITIS	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
RESTLESS LEGS SYNDROME	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (35)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Agenesis of corpus callosum	Agenesis Of Corpus Callosum	BEFREE	31156552		★★★★★ ★☆☆☆☆ Found in Text Mining only
Allergic rhinitis (disorder)	Allergic rhinitis	BEFREE	30417023		★★★★★ ★☆☆☆☆ Found in Text Mining only
Amaurosis congenita of Leber, type 1	Leber congenital amaurosis	BEFREE	27645772		★★★★★ ★☆☆☆☆ Found in Text Mining only
Amyotrophic Lateral Sclerosis	Amyotrophic Lateral Sclerosis	BEFREE	24708899, 30179644		★★★★★ ★☆☆☆☆ Found in Text Mining only
Aplasia Cutis Congenita	Aplasia Cutis Congenita	BEFREE	31156552		★★★★★ ★☆☆☆☆ Found in Text Mining only
Arteriosclerosis	Arteriosclerosis	BEFREE	30243560		★★★★★ ★☆☆☆☆ Found in Text Mining only
Atherosclerosis	Atherosclerosis	BEFREE	30243560		★★★★★ ★☆☆☆☆ Found in Text Mining only
Behcet Syndrome	Behcet disease	Pubtator	15196263	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	27012814		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colon Carcinoma	Colon Carcinoma	BEFREE	30066888		★★★★★ ★☆☆☆☆ Found in Text Mining only
Deglutition Disorders	Dysphagia	BEFREE	30179644		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes	Diabetes	BEFREE	12753499		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes Mellitus	BEFREE	12753499		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes mellitus	Pubtator	20956025	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus Type 1	Diabetes mellitus, type 1	Pubtator	25714914	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Ductal Carcinoma	Ductal Carcinoma	BEFREE	27012814		★★★★★ ★☆☆☆☆ Found in Text Mining only
Juvenile arthritis	Arthritis	CTD_human_DG	19565504		★★★★★ ★☆☆☆☆ Found in Text Mining only
Juvenile psoriatic arthritis	Juvenile arthritis	CTD_human_DG	19565504		★★★★★ ★☆☆☆☆ Found in Text Mining only
Juvenile-Onset Still Disease	Still Disease	CTD_human_DG	19565504		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	31744518		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	27012814		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of liver	Liver Cancer	BEFREE	31744518		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	BEFREE	26975529		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	27012814		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant tumor of colon	Colonic Neoplasms	BEFREE	30066888		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	27058423		★★★★★ ★☆☆☆☆ Found in Text Mining only
Polyarthritis, Juvenile, Rheumatoid Factor Negative	Seronegative polyarthritis	CTD_human_DG	19565504		★★★★★ ★☆☆☆☆ Found in Text Mining only
Polyarthritis, Juvenile, Rheumatoid Factor Positive	Polyarthritis, Rheumatoid Factor Positive	CTD_human_DG	19565504		★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostate carcinoma	Prostate cancer	BEFREE	26975529		★★★★★ ★☆☆☆☆ Found in Text Mining only
Respiratory Distress Syndrome	Respiratory Distress Syndrome	BEFREE	29411327		★★★★★ ★☆☆☆☆ Found in Text Mining only
Respiratory Distress Syndrome, Adult	Respiratory Distress Syndrome	BEFREE	29411327		★★★★★ ★☆☆☆☆ Found in Text Mining only
Respiratory Distress Syndrome, Newborn	Congenital alveolar dysplasia	BEFREE	29411327		★★★★★ ★☆☆☆☆ Found in Text Mining only
Secondary malignant neoplasm of colon and/or rectum	Colorectal Neoplasms	BEFREE	28261339, 30214231		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ulcerative Colitis	Ulcerative colitis	BEFREE	27805617		★★★★★ ★☆☆☆☆ Found in Text Mining only
Uveitis	Uveitis	Pubtator	15196263	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only

PCYT1B (phosphate cytidylyltransferase 1B, choline)