PICK1 (protein interacting with PRKCA 1)

Gene

• Entrez ID: 9463
• Gene name: Protein interacting with PRKCA 1
• Gene symbol: PICK1
• Synonyms (NCBI Gene): PICK, PRKCABP
• Chromosome: 22
• Chromosome location: 22q13.1
• Summary: The protein encoded by this gene contains a PDZ domain, through which it interacts with protein kinase C, alpha (PRKCA). This protein may function as an adaptor that binds to and organizes the subcellular localization of a variety of membrane proteins. It

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT756128	hsa-miR-3131	Luciferase reporter assay, Western blotting, qRT-PCR	36718590
MIRT1233011	hsa-miR-4419a	CLIP-seq
MIRT1233012	hsa-miR-4510	CLIP-seq
MIRT1233013	hsa-miR-4728-5p	CLIP-seq
MIRT1233014	hsa-miR-4743	CLIP-seq
MIRT1233015	hsa-miR-939	CLIP-seq
MIRT1233016	hsa-miR-1245b-5p	CLIP-seq
MIRT1233017	hsa-miR-1321	CLIP-seq
MIRT1233018	hsa-miR-1827	CLIP-seq
MIRT1233019	hsa-miR-214	CLIP-seq
MIRT1233020	hsa-miR-3142	CLIP-seq
MIRT1233021	hsa-miR-3612	CLIP-seq
MIRT1233022	hsa-miR-3619-5p	CLIP-seq
MIRT1233023	hsa-miR-4270	CLIP-seq
MIRT1233024	hsa-miR-4441	CLIP-seq
MIRT1233025	hsa-miR-4530	CLIP-seq
MIRT1233026	hsa-miR-4650-5p	CLIP-seq
MIRT1233027	hsa-miR-4690-5p	CLIP-seq
MIRT1233028	hsa-miR-4739	CLIP-seq
MIRT1233029	hsa-miR-4756-5p	CLIP-seq
MIRT1233030	hsa-miR-491-3p	CLIP-seq
MIRT1233031	hsa-miR-650	CLIP-seq
MIRT1233032	hsa-miR-761	CLIP-seq
MIRT1233033	hsa-miR-940	CLIP-seq
MIRT2068590	hsa-miR-34a	CLIP-seq
MIRT2068591	hsa-miR-34c-5p	CLIP-seq
MIRT2068592	hsa-miR-4302	CLIP-seq
MIRT2068593	hsa-miR-449a	CLIP-seq
MIRT2068594	hsa-miR-449b	CLIP-seq
MIRT2068595	hsa-miR-486-3p	CLIP-seq
MIRT2392503	hsa-miR-532-3p	CLIP-seq
MIRT2593534	hsa-miR-124	CLIP-seq
MIRT2593535	hsa-miR-3667-3p	CLIP-seq
MIRT2593536	hsa-miR-3691-3p	CLIP-seq
MIRT2593537	hsa-miR-3714	CLIP-seq
MIRT2593538	hsa-miR-3910	CLIP-seq
MIRT2593539	hsa-miR-4469	CLIP-seq
MIRT2593540	hsa-miR-4715-3p	CLIP-seq
MIRT2593541	hsa-miR-4736	CLIP-seq
MIRT2593542	hsa-miR-506	CLIP-seq
MIRT2593543	hsa-miR-642a	CLIP-seq
MIRT1233033	hsa-miR-940	CLIP-seq

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001664	Function	G protein-coupled receptor binding	ISS
GO:0002092	Process	Positive regulation of receptor internalization	IBA
GO:0002092	Process	Positive regulation of receptor internalization	ISS
GO:0003779	Function	Actin binding	IEA
GO:0005080	Function	Protein kinase C binding	IBA
GO:0005080	Function	Protein kinase C binding	ISS
GO:0005102	Function	Signaling receptor binding	ISS
GO:0005515	Function	Protein binding	IPI	11343649, 11802773, 16314870, 16713569, 21653829, 28514442, 31413325, 32296183, 32814053, 33961781, 37207277
GO:0005543	Function	Phospholipid binding	IBA
GO:0005737	Component	Cytoplasm	IDA	11343649, 16314870
GO:0005737	Component	Cytoplasm	IEA
GO:0005794	Component	Golgi apparatus	ISS
GO:0005829	Component	Cytosol	IDA
GO:0005856	Component	Cytoskeleton	IEA
GO:0005886	Component	Plasma membrane	IDA	11343649
GO:0005886	Component	Plasma membrane	TAS
GO:0006468	Process	Protein phosphorylation	ISS
GO:0006886	Process	Intracellular protein transport	IBA
GO:0008021	Component	Synaptic vesicle	IBA
GO:0014069	Component	Postsynaptic density	IBA
GO:0014069	Component	Postsynaptic density	IEA
GO:0015844	Process	Monoamine transport	IDA	11343649
GO:0016020	Component	Membrane	IEA
GO:0019904	Function	Protein domain specific binding	IEA
GO:0019904	Function	Protein domain specific binding	ISS
GO:0021782	Process	Glial cell development	ISS
GO:0030666	Component	Endocytic vesicle membrane	TAS
GO:0032588	Component	Trans-Golgi network membrane	IBA
GO:0034315	Process	Regulation of Arp2/3 complex-mediated actin nucleation	IBA
GO:0034316	Process	Negative regulation of Arp2/3 complex-mediated actin nucleation	ISS
GO:0036294	Process	Cellular response to decreased oxygen levels	ISS
GO:0042149	Process	Cellular response to glucose starvation	ISS
GO:0042734	Component	Presynaptic membrane	IDA	11343649
GO:0042802	Function	Identical protein binding	IPI	32296183
GO:0042802	Function	Identical protein binding	ISS
GO:0043005	Component	Neuron projection	IBA
GO:0043005	Component	Neuron projection	IEA
GO:0043005	Component	Neuron projection	ISS
GO:0043113	Process	Receptor clustering	IBA
GO:0043113	Process	Receptor clustering	ISS
GO:0045161	Process	Neuronal ion channel clustering	TAS	11343649
GO:0045202	Component	Synapse	IEA
GO:0045202	Component	Synapse	ISS
GO:0046872	Function	Metal ion binding	IEA
GO:0048471	Component	Perinuclear region of cytoplasm	IEA
GO:0048471	Component	Perinuclear region of cytoplasm	ISS
GO:0050796	Process	Regulation of insulin secretion	IMP	29768204
GO:0051015	Function	Actin filament binding	ISS
GO:0060292	Process	Long-term synaptic depression	ISS
GO:0071933	Function	Arp2/3 complex binding	ISS
GO:0097061	Process	Dendritic spine organization	ISS
GO:0097062	Process	Dendritic spine maintenance	IBA
GO:0097062	Process	Dendritic spine maintenance	ISS
GO:0140090	Function	Membrane curvature sensor activity	IDA	29768204

Other IDs

• MIM: 605926
• HGNC: 9394
• e!Ensembl: ENSG00000100151

Protein

• UniProt ID: Q9NRD5
• Protein name: PRKCA-binding protein (Protein interacting with C kinase 1) (Protein kinase C-alpha-binding protein)
• Protein function: Probable adapter protein that bind to and organize the subcellular localization of a variety of membrane proteins containing some PDZ recognition sequence. Involved in the clustering of various receptors, possibly by acting at the receptor inter
• PDB: 2GZV, 6AR4, 6BJN, 6BJO
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00595	PDZ	22 → 102	PDZ domain	Domain
  PF06456	Arfaptin	117 → 352	Arfaptin-like domain	Domain

• Tissue specificity: TISSUE SPECIFICITY: Ubiquitous.
• Sequence:

  MFADLDYDIEEDKLGIPTVPGKVTLQKDAQNLIGISIGGGAQYCPCLYIVQVFDNTPAAL
  DGTVAAGDEITGVNGRSIKGKTKVEVAKMIQEVKGEVTIHYNKLQADPKQGMSLDIVLKK
  VKHRLVENMSSGTADALGLSRAILCNDGLVKRLEELERTAELYKGMTEHTKNLLRAFYEL
  SQTHRAFGDVFSVIGVREPQPAASEAFVKFADAHRSIEKFGIRLLKTIKPMLTDLNTYLN
  KAIPDTRLTIKKYLDVKFEYLSYCLKVKEMDDEEYSCIALGEPLYRVSTGNYEYRLILRC
  RQEARARFSQMRKDVLEKMELLDQKHVQDIVFQLQRLVSTMSKYYNDCYAVLRDADVFPI
  EVDLAHTTLAYGLNQEEFTDGEEEEEEEDTAAGEPSRDTRGAAGPLDKGGSWCDS

• Sequence length: 415

Pathways

Reactome:

Trafficking of GluR2-containing AMPA receptors

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
AMPHETAMINE OR RELATED ACTING SYMPATHOMIMETIC ABUSE	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
AMPHETAMINE-RELATED DISORDERS	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MALE INFERTILITY DUE TO GLOBOZOOSPERMIA	—	GWAS catalog, Orphanet GWAS catalog, Orphanet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MALE INFERTILITY DUE TO ROUND-HEADED SPERMATOZOA	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
NONORGANIC PSYCHOSIS	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PICK1-related disorder	Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PSYCHOSES, SUBSTANCE-INDUCED	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PSYCHOTIC DISORDERS	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SCHIZOPHRENIA	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Amyotrophic Lateral Sclerosis	Amyotrophic Lateral Sclerosis	BEFREE	23436724		★☆☆☆☆ Found in Text Mining only
Arteriovenous Malformations	Arteriovenous malformations	Pubtator	36718590	Associate	★☆☆☆☆ Found in Text Mining only
Astrocytoma	Astrocytoma	Pubtator	26466675	Inhibit	★☆☆☆☆ Found in Text Mining only
Blindness	Blindness	Pubtator	33877510	Associate	★☆☆☆☆ Found in Text Mining only
Carcinogenesis	Carcinogenesis	Pubtator	26466675	Associate	★☆☆☆☆ Found in Text Mining only
Congestive heart failure	Congestive Heart Failure	BEFREE	26970394		★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes mellitus	Pubtator	35077398	Associate	★☆☆☆☆ Found in Text Mining only
Diabetic Nephropathy	Diabetic Nephropathy	BEFREE	21321125		★☆☆☆☆ Found in Text Mining only
Epilepsy	Epilepsy	BEFREE	28888867		★☆☆☆☆ Found in Text Mining only
Familial lichen amyloidosis	Lichen amyloidosis	BEFREE	28697177		★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	BEFREE	26466675		★☆☆☆☆ Found in Text Mining only
Heart failure	Heart Failure	BEFREE	26970394		★☆☆☆☆ Found in Text Mining only
Hyperglycemia	Hyperglycemia	BEFREE	21321125		★☆☆☆☆ Found in Text Mining only
Hyperinsulinism	Hyperinsulinism	BEFREE	31735337		★☆☆☆☆ Found in Text Mining only
Machado-Joseph Disease	Machado-Joseph Disease	BEFREE	21949352		★☆☆☆☆ Found in Text Mining only
Male infertility due to globozoospermia	Male infertility	Orphanet			★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Malignant neoplasm of prostate	Prostate cancer	BEFREE	28697177		★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	26466675		★☆☆☆☆ Found in Text Mining only
nervous system disorder	Nervous System Disorder	BEFREE	23436724		★☆☆☆☆ Found in Text Mining only
Neurodegenerative Disorders	Neurodegenerative Disorders	BEFREE	21949352, 29280296, 30194389		★☆☆☆☆ Found in Text Mining only
Nonorganic psychosis	Nonorganic Psychosis	BEFREE	17606663		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Nonorganic psychosis	Nonorganic Psychosis	PSYGENET_DG	17606663		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Prostate carcinoma	Prostate cancer	BEFREE	28697177		★☆☆☆☆ Found in Text Mining only
Psychotic Disorders	Psychosis	BEFREE	17606663		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Psychotic Disorders	Psychosis	PSYGENET_DG	17606663		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Schizophrenia	Schizophrenia	BEFREE	15305146, 16314870, 16983646, 17011050, 17367885, 28507309		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Schizophrenia	Schizophrenia	LHGDN	15305146, 16314870, 17367885		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Schizophrenia	Schizophrenia	PSYGENET_DG	15305146, 16314870, 16983646, 17367885		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Septicemia	Septicemia	BEFREE	29471107		★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	31886120	Associate	★☆☆☆☆ Found in Text Mining only
Teratozoospermia	Teratozoospermia	Pubtator	20562896, 21397063	Associate	★☆☆☆☆ Found in Text Mining only