Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	9462
Gene name	RAS protein activator like 2
Gene symbol	RASAL2
Synonyms (NCBI Gene)	NGAP
Chromosome	1
Chromosome location	1q25.2
Summary	This gene encodes a protein that contains the GAP-related domain (GRD), a characteristic domain of GTPase-activating proteins (GAPs). GAPs function as activators of Ras superfamily of small GTPases. The protein encoded by this gene is able to complement t

220

Show/Hide all (220)

miRTarBase ID	miRNA	Experiments	Reference
MIRT027468	hsa-miR-98-5p	Microarray	19088304
MIRT029026	hsa-miR-26b-5p	Microarray	19088304
MIRT048987	hsa-miR-92a-3p	qRT-PCR	23622248
MIRT048987	hsa-miR-92a-3p	CLASH	23622248
MIRT048603	hsa-miR-99a-5p	CLASH	23622248
MIRT045969	hsa-miR-125b-5p	CLASH	23622248
MIRT038984	hsa-miR-15a-3p	CLASH	23622248
MIRT053439	hsa-miR-203a-3p	Microarray	23807165
MIRT654446	hsa-miR-3606-3p	HITS-CLIP	23824327
MIRT654445	hsa-miR-513a-3p	HITS-CLIP	23824327
MIRT654444	hsa-miR-513c-3p	HITS-CLIP	23824327
MIRT654443	hsa-miR-4639-5p	HITS-CLIP	23824327
MIRT654442	hsa-miR-129-5p	HITS-CLIP	23824327
MIRT469544	hsa-miR-5583-3p	PAR-CLIP	23592263
MIRT469543	hsa-miR-511-3p	PAR-CLIP	23592263
MIRT469542	hsa-miR-6867-5p	PAR-CLIP	23592263
MIRT654446	hsa-miR-3606-3p	HITS-CLIP	23824327
MIRT654445	hsa-miR-513a-3p	HITS-CLIP	23824327
MIRT654444	hsa-miR-513c-3p	HITS-CLIP	23824327
MIRT654443	hsa-miR-4639-5p	HITS-CLIP	23824327
MIRT654442	hsa-miR-129-5p	HITS-CLIP	23824327
MIRT469544	hsa-miR-5583-3p	PAR-CLIP	23592263
MIRT469543	hsa-miR-511-3p	PAR-CLIP	23592263
MIRT469542	hsa-miR-6867-5p	PAR-CLIP	23592263
MIRT739876	hsa-miR-1229	CLIP-seq
MIRT1292007	hsa-miR-127-5p	CLIP-seq
MIRT1292008	hsa-miR-1297	CLIP-seq
MIRT1292009	hsa-miR-140-3p	CLIP-seq
MIRT739875	hsa-miR-197	CLIP-seq
MIRT1292010	hsa-miR-26a	CLIP-seq
MIRT1292011	hsa-miR-26b	CLIP-seq
MIRT1292012	hsa-miR-29a	CLIP-seq
MIRT1292013	hsa-miR-29b	CLIP-seq
MIRT1292014	hsa-miR-29c	CLIP-seq
MIRT1292015	hsa-miR-3125	CLIP-seq
MIRT1292016	hsa-miR-3145-3p	CLIP-seq
MIRT1292017	hsa-miR-3184	CLIP-seq
MIRT1292018	hsa-miR-3185	CLIP-seq
MIRT1292019	hsa-miR-345	CLIP-seq
MIRT1292020	hsa-miR-3691-3p	CLIP-seq
MIRT1292021	hsa-miR-3916	CLIP-seq
MIRT1292022	hsa-miR-3936	CLIP-seq
MIRT1292023	hsa-miR-410	CLIP-seq
MIRT1292024	hsa-miR-423-5p	CLIP-seq
MIRT1292025	hsa-miR-4256	CLIP-seq
MIRT1292026	hsa-miR-4271	CLIP-seq
MIRT1292027	hsa-miR-4282	CLIP-seq
MIRT739877	hsa-miR-4433	CLIP-seq
MIRT739878	hsa-miR-4459	CLIP-seq
MIRT1292028	hsa-miR-4461	CLIP-seq
MIRT1292029	hsa-miR-4465	CLIP-seq
MIRT1292030	hsa-miR-4517	CLIP-seq
MIRT1292031	hsa-miR-4662a-3p	CLIP-seq
MIRT1292032	hsa-miR-4686	CLIP-seq
MIRT1292033	hsa-miR-4698	CLIP-seq
MIRT1292034	hsa-miR-4699-3p	CLIP-seq
MIRT1292035	hsa-miR-4718	CLIP-seq
MIRT1292036	hsa-miR-4725-3p	CLIP-seq
MIRT1292037	hsa-miR-4731-5p	CLIP-seq
MIRT1292038	hsa-miR-4762-3p	CLIP-seq
MIRT739879	hsa-miR-4768-3p	CLIP-seq
MIRT1292039	hsa-miR-4777-3p	CLIP-seq
MIRT1292040	hsa-miR-4789-3p	CLIP-seq
MIRT1292041	hsa-miR-498	CLIP-seq
MIRT1292042	hsa-miR-555	CLIP-seq
MIRT1292007	hsa-miR-127-5p	CLIP-seq
MIRT1292043	hsa-miR-130a	CLIP-seq
MIRT1292044	hsa-miR-130b	CLIP-seq
MIRT1292045	hsa-miR-203	CLIP-seq
MIRT1292046	hsa-miR-218	CLIP-seq
MIRT1292047	hsa-miR-25	CLIP-seq
MIRT1292048	hsa-miR-27a	CLIP-seq
MIRT1292049	hsa-miR-27b	CLIP-seq
MIRT1292050	hsa-miR-301a	CLIP-seq
MIRT1292051	hsa-miR-301b	CLIP-seq
MIRT1292052	hsa-miR-3120-3p	CLIP-seq
MIRT1292015	hsa-miR-3125	CLIP-seq
MIRT1292053	hsa-miR-3126-5p	CLIP-seq
MIRT1292054	hsa-miR-3146	CLIP-seq
MIRT1292055	hsa-miR-32	CLIP-seq
MIRT1292056	hsa-miR-323-3p	CLIP-seq
MIRT1292057	hsa-miR-340	CLIP-seq
MIRT1292058	hsa-miR-342-3p	CLIP-seq
MIRT1292019	hsa-miR-345	CLIP-seq
MIRT1292059	hsa-miR-34a	CLIP-seq
MIRT1292060	hsa-miR-34c-5p	CLIP-seq
MIRT1292061	hsa-miR-3614-5p	CLIP-seq
MIRT1292062	hsa-miR-361-5p	CLIP-seq
MIRT1292063	hsa-miR-3617	CLIP-seq
MIRT1292064	hsa-miR-363	CLIP-seq
MIRT1292065	hsa-miR-3666	CLIP-seq
MIRT1292066	hsa-miR-3669	CLIP-seq
MIRT1292067	hsa-miR-367	CLIP-seq
MIRT1292068	hsa-miR-3680	CLIP-seq
MIRT1292069	hsa-miR-371-5p	CLIP-seq
MIRT1292021	hsa-miR-3916	CLIP-seq
MIRT1292070	hsa-miR-3942-5p	CLIP-seq
MIRT1292025	hsa-miR-4256	CLIP-seq
MIRT1292071	hsa-miR-4261	CLIP-seq
MIRT1292072	hsa-miR-4295	CLIP-seq
MIRT1292073	hsa-miR-4325	CLIP-seq
MIRT1292074	hsa-miR-4419a	CLIP-seq
MIRT1292075	hsa-miR-4477a	CLIP-seq
MIRT1292076	hsa-miR-449a	CLIP-seq
MIRT1292077	hsa-miR-449b	CLIP-seq
MIRT1292078	hsa-miR-4510	CLIP-seq
MIRT1292030	hsa-miR-4517	CLIP-seq
MIRT1292079	hsa-miR-454	CLIP-seq
MIRT1292080	hsa-miR-4652-3p	CLIP-seq
MIRT1292032	hsa-miR-4686	CLIP-seq
MIRT1292081	hsa-miR-4695-3p	CLIP-seq
MIRT1292082	hsa-miR-4696	CLIP-seq
MIRT1292083	hsa-miR-4703-5p	CLIP-seq
MIRT1292084	hsa-miR-4716-5p	CLIP-seq
MIRT1292035	hsa-miR-4718	CLIP-seq
MIRT1292085	hsa-miR-4726-3p	CLIP-seq
MIRT1292086	hsa-miR-4728-3p	CLIP-seq
MIRT1292087	hsa-miR-4753-3p	CLIP-seq
MIRT1292038	hsa-miR-4762-3p	CLIP-seq
MIRT1292088	hsa-miR-4773	CLIP-seq
MIRT1292089	hsa-miR-4778-5p	CLIP-seq
MIRT1292090	hsa-miR-4802-5p	CLIP-seq
MIRT1292091	hsa-miR-495	CLIP-seq
MIRT1292092	hsa-miR-513a-5p	CLIP-seq
MIRT1292093	hsa-miR-519a	CLIP-seq
MIRT1292094	hsa-miR-519b-3p	CLIP-seq
MIRT1292095	hsa-miR-519c-3p	CLIP-seq
MIRT1292096	hsa-miR-582-5p	CLIP-seq
MIRT1292097	hsa-miR-636	CLIP-seq
MIRT1292098	hsa-miR-641	CLIP-seq
MIRT1292099	hsa-miR-656	CLIP-seq
MIRT1292100	hsa-miR-676	CLIP-seq
MIRT1292101	hsa-miR-92a	CLIP-seq
MIRT1292102	hsa-miR-92b	CLIP-seq
MIRT1292103	hsa-miR-944	CLIP-seq
MIRT2086837	hsa-miR-128	CLIP-seq
MIRT2086838	hsa-miR-151-3p	CLIP-seq
MIRT2086839	hsa-miR-2113	CLIP-seq
MIRT2086840	hsa-miR-326	CLIP-seq
MIRT2086841	hsa-miR-330-5p	CLIP-seq
MIRT1292063	hsa-miR-3617	CLIP-seq
MIRT2086842	hsa-miR-3686	CLIP-seq
MIRT2086843	hsa-miR-4254	CLIP-seq
MIRT1292027	hsa-miR-4282	CLIP-seq
MIRT2086844	hsa-miR-4491	CLIP-seq
MIRT2086845	hsa-miR-4511	CLIP-seq
MIRT1292080	hsa-miR-4652-3p	CLIP-seq
MIRT2086846	hsa-miR-4657	CLIP-seq
MIRT1292082	hsa-miR-4696	CLIP-seq
MIRT2086847	hsa-miR-4719	CLIP-seq
MIRT2086848	hsa-miR-4722-5p	CLIP-seq
MIRT739879	hsa-miR-4768-3p	CLIP-seq
MIRT2086849	hsa-miR-4778-3p	CLIP-seq
MIRT1292089	hsa-miR-4778-5p	CLIP-seq
MIRT2086850	hsa-miR-493	CLIP-seq
MIRT1292098	hsa-miR-641	CLIP-seq
MIRT1292016	hsa-miR-3145-3p	CLIP-seq
MIRT2311746	hsa-miR-3689a-5p	CLIP-seq
MIRT2311747	hsa-miR-3689b	CLIP-seq
MIRT2311748	hsa-miR-3689e	CLIP-seq
MIRT2311749	hsa-miR-3689f	CLIP-seq
MIRT1292080	hsa-miR-4652-3p	CLIP-seq
MIRT2311750	hsa-miR-216a	CLIP-seq
MIRT2311751	hsa-miR-216b	CLIP-seq
MIRT2311752	hsa-miR-374a	CLIP-seq
MIRT2311753	hsa-miR-374b	CLIP-seq
MIRT2393499	hsa-miR-1193	CLIP-seq
MIRT2393500	hsa-miR-135a	CLIP-seq
MIRT2393501	hsa-miR-135b	CLIP-seq
MIRT2393502	hsa-miR-3143	CLIP-seq
MIRT2393503	hsa-miR-3545-3p	CLIP-seq
MIRT2393504	hsa-miR-4473	CLIP-seq
MIRT2393505	hsa-miR-512-3p	CLIP-seq
MIRT2393506	hsa-miR-520f	CLIP-seq
MIRT2393507	hsa-miR-543	CLIP-seq
MIRT2393508	hsa-miR-609	CLIP-seq
MIRT2432449	hsa-miR-4520a-3p	CLIP-seq
MIRT2608189	hsa-miR-1305	CLIP-seq
MIRT2608190	hsa-miR-194	CLIP-seq
MIRT2608191	hsa-miR-3065-5p	CLIP-seq
MIRT1292015	hsa-miR-3125	CLIP-seq
MIRT2608192	hsa-miR-3160-5p	CLIP-seq
MIRT1292058	hsa-miR-342-3p	CLIP-seq
MIRT1292066	hsa-miR-3669	CLIP-seq
MIRT2608193	hsa-miR-3682-5p	CLIP-seq
MIRT2608194	hsa-miR-3685	CLIP-seq
MIRT2608195	hsa-miR-377	CLIP-seq
MIRT2608196	hsa-miR-383	CLIP-seq
MIRT1292021	hsa-miR-3916	CLIP-seq
MIRT2608197	hsa-miR-421	CLIP-seq
MIRT2608198	hsa-miR-4418	CLIP-seq
MIRT2608199	hsa-miR-4661-5p	CLIP-seq
MIRT1292081	hsa-miR-4695-3p	CLIP-seq
MIRT2608200	hsa-miR-4709-5p	CLIP-seq
MIRT2608201	hsa-miR-4772-5p	CLIP-seq
MIRT2608202	hsa-miR-4799-5p	CLIP-seq
MIRT2608203	hsa-miR-486-5p	CLIP-seq
MIRT2608204	hsa-miR-494	CLIP-seq
MIRT2608205	hsa-miR-509-3-5p	CLIP-seq
MIRT2608206	hsa-miR-509-5p	CLIP-seq
MIRT2393506	hsa-miR-520f	CLIP-seq
MIRT2608207	hsa-miR-563	CLIP-seq
MIRT2608208	hsa-miR-570	CLIP-seq
MIRT2608190	hsa-miR-194	CLIP-seq
MIRT2608192	hsa-miR-3160-5p	CLIP-seq
MIRT2689357	hsa-miR-3658	CLIP-seq
MIRT2608193	hsa-miR-3682-5p	CLIP-seq
MIRT2608194	hsa-miR-3685	CLIP-seq
MIRT2608195	hsa-miR-377	CLIP-seq
MIRT2608196	hsa-miR-383	CLIP-seq
MIRT2608198	hsa-miR-4418	CLIP-seq
MIRT2689358	hsa-miR-4693-3p	CLIP-seq
MIRT2608200	hsa-miR-4709-5p	CLIP-seq
MIRT2608201	hsa-miR-4772-5p	CLIP-seq
MIRT2608203	hsa-miR-486-5p	CLIP-seq
MIRT2608204	hsa-miR-494	CLIP-seq
MIRT2608205	hsa-miR-509-3-5p	CLIP-seq
MIRT2608206	hsa-miR-509-5p	CLIP-seq
MIRT2393506	hsa-miR-520f	CLIP-seq
MIRT2608207	hsa-miR-563	CLIP-seq

Show/Hide all (13)

GO ID	Ontology	Definition	Evidence	Reference
GO:0002021	Process	Response to dietary excess	IEA
GO:0005096	Function	GTPase activator activity	IBA
GO:0005096	Function	GTPase activator activity	IEA
GO:0005096	Function	GTPase activator activity	TAS	9877179
GO:0005515	Function	Protein binding	IPI	14743216, 18985028, 25416956, 32296183, 33961781
GO:0005829	Component	Cytosol	TAS
GO:0007165	Process	Signal transduction	TAS	9877179
GO:0009749	Process	Response to glucose	IEA
GO:0010467	Process	Gene expression	IEA
GO:0035264	Process	Multicellular organism growth	IEA
GO:0060612	Process	Adipose tissue development	IEA
GO:1902531	Process	Regulation of intracellular signal transduction	IBA
GO:2000257	Process	Regulation of protein activation cascade	IEA

MIM	HGNC	e!Ensembl
606136	9874	ENSG00000075391

Q9UJF2

Protein name

Ras GTPase-activating protein nGAP (RAS protein activator-like 2)

Protein function

Inhibitory regulator of the Ras-cyclic AMP pathway.

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00168	C2	169 → 269	C2 domain	Domain
PF00616	RasGAP	348 → 420	GTPase-activator protein for Ras-like GTPase	Family
PF00616	RasGAP	414 → 519	GTPase-activator protein for Ras-like GTPase	Family
PF12004	DUF3498	609 → 1110	Domain of unknown function (DUF3498)	Family

Sequence

MQTPEVPAERSPRRRSISGTSTSEKPNSMDTANTSPFKVPGFFSKRLKGSIKRTKSQSKL
DRNTSFRLPSLRSTDDRSRGLPKLKESRSHESLLSPCSTVECLDLGRGEPVSVKPLHSSI
LGQDFCFEVTYLSGSKCFSCNSASERDKWMENLRRTVQPNKDNCRRAENVLRLWIIEAKD
LAPKKKYFCELCLDDTLFARTTSKTKADNIFWGEHFEFFSLPPLHSITVHIYKDVEKKKK
KDKNNYVGLVNIPTASVTGRQFVEKWYPVSTPTPNKGKTGGPSIRIKSRFQTITILPMEQ
YKEFAEFVTSNYTMLCSVLEPVISVRNKEELACALVHILQSTGRAKDFLTDLVMSEVDRC
GEHDVLIFRENTIATKSIEEYLKLVGQQYLHDALGEFIKALYESDENCEVDPSKCSSSEL
IDHQSNLKMCCELAFCKIINSYCVFPRELKEVFASWKQQCLNRGKQDISERLISASLFLR
FLCPAIMSPSLFNLMQEYPDDRTSRTLTLIAKVIQNLANFAKFGNKEEYMAFMNDFLEHE
WGGMKRFLLEISNPDTISNTPGFDGYIDLGRELSVLHSLLWEVVSQLDKGENSFLQATVA
KLGPLPRVLADITKSLTNPTPIQQQLRRFTEHNSSPNVSGSLSSGLQKIFEDPTDSDLHK
LKSPSQDNTDSYFRGKTLLLVQQASSQSMTYSEKDERESSLPNGRSVSLMDLQDTHAAQV
EHASVMLDVPIRLTGSQLSITQVASIKQLRETQSTPQSAPQVRRPLHPALNQPGGLQPLS
FQNPVYHLNNPIPAMPKASIDSSLENLSTASSRSQSNSEDFKLSGPSNSSMEDFTKRSTQ
SEDFSRRHTVPDRHIPLALPRQNSTGQAQIRKVDQGGLGARAKAPPSLPHSASLRSTGSM
SVVSAALVAEPVQNGSRSRQQSSSSRESPVPKVRAIQRQQTQQVQSPVDSATMSPVERTA
AWVLNNGQYEEDVEETEQNLDEAKHAEKYEQEITKLKERLRVSSRRLEEYERRLLVQEQQ
MQKLLLEYKARLEDSEERLRRQQEEKDSQMKSIISRLMAVEEELKKDHAEMQAVIDAKQK
IIDAQEKRIVSLDSANTRLMSALTQVKERYSMQVRNGISPTNPTKLSITENGEFKNSSC

Sequence length

1139

Interactions

View interactions

	KEGG		Reactome
	Ras signaling pathway		Regulation of RAS by GAPs

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (5)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
AUTISTIC DISORDER	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BIPOLAR DISORDER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
COLORECTAL CANCER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Prostate cancer	Uncertain significance	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
STOMACH NEOPLASMS	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (34)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Bipolar Disorder	Bipolar Disorder	GWASCAT_DG	28115744		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Bladder Neoplasm	Bladder Neoplasm	BEFREE	28182001, 29702203		★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	24029223, 24029233, 25216515, 25384218, 27108696, 31473883, 31759919		★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	28167613	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma	Carcinoma	Pubtator	24718460	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma of bladder	Bladder carcinoma	BEFREE	28182001, 29702203		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Pancreatic Ductal	Pancreatic ductal carcinoma	Pubtator	34863899	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Pancreatic Ductal	Pancreatic ductal carcinoma	Pubtator	35844783	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma, Ovarian Epithelial	Ovarian Epithelial carcinoma	BEFREE	25216515		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	28454265, 30037330, 31799194		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	UNIPROT_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Conventional (Clear Cell) Renal Cell Carcinoma	Renal Carcinoma	BEFREE	30158581		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	28447723		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	24029223, 24029233, 25216515, 25384218, 27108696, 31473883, 31759919		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	UNIPROT_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of ovary	Ovarian cancer	BEFREE	25216515		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of pancreas	Pancreatic cancer	BEFREE	31044154		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of stomach	Stomach Neoplasms	BEFREE	20473946		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of urinary bladder	Urinary bladder cancer	BEFREE	28182001, 29702203		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	24029223, 28447723, 28454265, 31799194		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	BEFREE	25384218		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	24029233, 25216515, 25384218, 28182001, 28447723, 28454265, 30037330, 31044154, 31473883, 31759919, 31799194		★★★★★ ★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	Pubtator	23950976	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Oestrogen receptor positive breast cancer	Oestrogen Receptor Positive Breast Cancer	BEFREE	31759919		★★★★★ ★☆☆☆☆ Found in Text Mining only
ovarian neoplasm	Ovarian neoplasm	BEFREE	25216515		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Ovarian neoplasm	Pubtator	34193694	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatic carcinoma	Pancreatic carcinoma	BEFREE	31044154		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatic Ductal Adenocarcinoma	Pancreatic adenocarcinoma	BEFREE	31799194		★★★★★ ★☆☆☆☆ Found in Text Mining only
Patent ductus arteriosus	Patent ductus arteriosus	BEFREE	31044154		★★★★★ ★☆☆☆☆ Found in Text Mining only
Renal Cell Carcinoma	Renal Carcinoma	BEFREE	30158581		★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Carcinoma	Stomach Carcinoma	BEFREE	20473946		★★★★★ ★☆☆☆☆ Found in Text Mining only
Thyroid Neoplasms	Thyroid cancer	Pubtator	24718460, 32737449	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Triple Negative Breast Neoplasms	Triple Negative Breast Neoplasms	BEFREE	25384218, 27108696		★★★★★ ★☆☆☆☆ Found in Text Mining only
Triple Negative Breast Neoplasms	Triple negative breast cancer	Pubtator	34168046, 34193694	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only

RASAL2 (RAS protein activator like 2)