Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	9456
Gene name	Homer scaffold protein 1
Gene symbol	HOMER1
Synonyms (NCBI Gene)	HOMERHOMER1AHOMER1BHOMER1CSYN47Ves-1
Chromosome	5
Chromosome location	5q14.1
Summary	This gene encodes a member of the homer family of dendritic proteins. Members of this family regulate group 1 metabotrophic glutamate receptor function. [provided by RefSeq, Jul 2008]

154

Show/Hide all (154)

miRTarBase ID	miRNA	Experiments	Reference
MIRT032118	hsa-let-7d-5p	Sequencing	20371350
MIRT042276	hsa-miR-484	CLASH	23622248
MIRT614961	hsa-miR-19a-3p	HITS-CLIP	23824327
MIRT614960	hsa-miR-19b-3p	HITS-CLIP	23824327
MIRT614959	hsa-miR-6074	HITS-CLIP	23824327
MIRT614958	hsa-miR-4272	HITS-CLIP	23824327
MIRT614957	hsa-miR-2113	HITS-CLIP	23824327
MIRT614956	hsa-miR-5010-3p	HITS-CLIP	23824327
MIRT614955	hsa-miR-129-5p	HITS-CLIP	23824327
MIRT614961	hsa-miR-19a-3p	HITS-CLIP	23824327
MIRT614960	hsa-miR-19b-3p	HITS-CLIP	23824327
MIRT614959	hsa-miR-6074	HITS-CLIP	23824327
MIRT614958	hsa-miR-4272	HITS-CLIP	23824327
MIRT614957	hsa-miR-2113	HITS-CLIP	23824327
MIRT614956	hsa-miR-5010-3p	HITS-CLIP	23824327
MIRT614955	hsa-miR-129-5p	HITS-CLIP	23824327
MIRT614961	hsa-miR-19a-3p	HITS-CLIP	23824327
MIRT614960	hsa-miR-19b-3p	HITS-CLIP	23824327
MIRT614959	hsa-miR-6074	HITS-CLIP	23824327
MIRT614958	hsa-miR-4272	HITS-CLIP	23824327
MIRT614957	hsa-miR-2113	HITS-CLIP	23824327
MIRT614956	hsa-miR-5010-3p	HITS-CLIP	23824327
MIRT614955	hsa-miR-129-5p	HITS-CLIP	23824327
MIRT614955	hsa-miR-129-5p	HITS-CLIP	27418678
MIRT614955	hsa-miR-129-5p	HITS-CLIP	27418678
MIRT614961	hsa-miR-19a-3p	HITS-CLIP	27418678
MIRT614960	hsa-miR-19b-3p	HITS-CLIP	27418678
MIRT614957	hsa-miR-2113	HITS-CLIP	27418678
MIRT614957	hsa-miR-2113	HITS-CLIP	27418678
MIRT614956	hsa-miR-5010-3p	HITS-CLIP	27418678
MIRT614956	hsa-miR-5010-3p	HITS-CLIP	27418678
MIRT733515	hsa-miR-1200	Microarray	34164896
MIRT614961	hsa-miR-19a-3p	HITS-CLIP	23824327
MIRT614960	hsa-miR-19b-3p	HITS-CLIP	23824327
MIRT614959	hsa-miR-6074	HITS-CLIP	23824327
MIRT614958	hsa-miR-4272	HITS-CLIP	23824327
MIRT614957	hsa-miR-2113	HITS-CLIP	23824327
MIRT614956	hsa-miR-5010-3p	HITS-CLIP	23824327
MIRT614955	hsa-miR-129-5p	HITS-CLIP	23824327
MIRT614961	hsa-miR-19a-3p	HITS-CLIP	23824327
MIRT614960	hsa-miR-19b-3p	HITS-CLIP	23824327
MIRT614959	hsa-miR-6074	HITS-CLIP	23824327
MIRT614958	hsa-miR-4272	HITS-CLIP	23824327
MIRT614957	hsa-miR-2113	HITS-CLIP	23824327
MIRT614956	hsa-miR-5010-3p	HITS-CLIP	23824327
MIRT614955	hsa-miR-129-5p	HITS-CLIP	23824327
MIRT614961	hsa-miR-19a-3p	HITS-CLIP	23824327
MIRT614960	hsa-miR-19b-3p	HITS-CLIP	23824327
MIRT614959	hsa-miR-6074	HITS-CLIP	23824327
MIRT614958	hsa-miR-4272	HITS-CLIP	23824327
MIRT614957	hsa-miR-2113	HITS-CLIP	23824327
MIRT614956	hsa-miR-5010-3p	HITS-CLIP	23824327
MIRT614955	hsa-miR-129-5p	HITS-CLIP	23824327
MIRT1052525	hsa-miR-1278	CLIP-seq
MIRT1052526	hsa-miR-1284	CLIP-seq
MIRT1052527	hsa-miR-150	CLIP-seq
MIRT1052528	hsa-miR-192	CLIP-seq
MIRT1052529	hsa-miR-2053	CLIP-seq
MIRT1052530	hsa-miR-215	CLIP-seq
MIRT1052531	hsa-miR-300	CLIP-seq
MIRT1052532	hsa-miR-3074-3p	CLIP-seq
MIRT1052533	hsa-miR-3145-3p	CLIP-seq
MIRT1052534	hsa-miR-3148	CLIP-seq
MIRT1052535	hsa-miR-338-3p	CLIP-seq
MIRT1052536	hsa-miR-33a	CLIP-seq
MIRT1052537	hsa-miR-33b	CLIP-seq
MIRT1052538	hsa-miR-3613-3p	CLIP-seq
MIRT1052539	hsa-miR-3671	CLIP-seq
MIRT1052540	hsa-miR-3674	CLIP-seq
MIRT1052541	hsa-miR-3689a-5p	CLIP-seq
MIRT1052542	hsa-miR-3689b	CLIP-seq
MIRT1052543	hsa-miR-3689d	CLIP-seq
MIRT1052544	hsa-miR-3689e	CLIP-seq
MIRT1052545	hsa-miR-3689f	CLIP-seq
MIRT1052546	hsa-miR-3690	CLIP-seq
MIRT1052547	hsa-miR-381	CLIP-seq
MIRT1052548	hsa-miR-3921	CLIP-seq
MIRT1052549	hsa-miR-3926	CLIP-seq
MIRT1052550	hsa-miR-410	CLIP-seq
MIRT1052551	hsa-miR-4254	CLIP-seq
MIRT1052552	hsa-miR-4287	CLIP-seq
MIRT1052553	hsa-miR-4303	CLIP-seq
MIRT1052554	hsa-miR-4305	CLIP-seq
MIRT1052555	hsa-miR-4318	CLIP-seq
MIRT1052556	hsa-miR-4469	CLIP-seq
MIRT1052557	hsa-miR-4501	CLIP-seq
MIRT1052558	hsa-miR-4511	CLIP-seq
MIRT1052559	hsa-miR-4530	CLIP-seq
MIRT1052560	hsa-miR-4653-5p	CLIP-seq
MIRT1052561	hsa-miR-4666-3p	CLIP-seq
MIRT1052562	hsa-miR-4680-5p	CLIP-seq
MIRT1052563	hsa-miR-4685-3p	CLIP-seq
MIRT1052564	hsa-miR-4693-5p	CLIP-seq
MIRT1052565	hsa-miR-4698	CLIP-seq
MIRT1052566	hsa-miR-4703-3p	CLIP-seq
MIRT1052567	hsa-miR-4705	CLIP-seq
MIRT1052568	hsa-miR-4713-5p	CLIP-seq
MIRT1052569	hsa-miR-4718	CLIP-seq
MIRT1052570	hsa-miR-4742-3p	CLIP-seq
MIRT1052571	hsa-miR-4764-5p	CLIP-seq
MIRT1052572	hsa-miR-4765	CLIP-seq
MIRT1052573	hsa-miR-4796-5p	CLIP-seq
MIRT1052574	hsa-miR-4799-5p	CLIP-seq
MIRT1052575	hsa-miR-4802-3p	CLIP-seq
MIRT1052576	hsa-miR-4802-5p	CLIP-seq
MIRT1052577	hsa-miR-518a-5p	CLIP-seq
MIRT1052578	hsa-miR-527	CLIP-seq
MIRT1052579	hsa-miR-532-3p	CLIP-seq
MIRT1052580	hsa-miR-548s	CLIP-seq
MIRT1052581	hsa-miR-569	CLIP-seq
MIRT1052582	hsa-miR-578	CLIP-seq
MIRT1052583	hsa-miR-592	CLIP-seq
MIRT1052584	hsa-miR-595	CLIP-seq
MIRT1052585	hsa-miR-597	CLIP-seq
MIRT1052586	hsa-miR-765	CLIP-seq
MIRT1052587	hsa-miR-873	CLIP-seq
MIRT1052588	hsa-miR-889	CLIP-seq
MIRT1052589	hsa-miR-892a	CLIP-seq
MIRT1052590	hsa-miR-944	CLIP-seq
MIRT1920484	hsa-miR-361-5p	CLIP-seq
MIRT1920485	hsa-miR-3919	CLIP-seq
MIRT1920486	hsa-miR-4756-3p	CLIP-seq
MIRT1920487	hsa-miR-539	CLIP-seq
MIRT1920484	hsa-miR-361-5p	CLIP-seq
MIRT1920485	hsa-miR-3919	CLIP-seq
MIRT1920486	hsa-miR-4756-3p	CLIP-seq
MIRT1920487	hsa-miR-539	CLIP-seq
MIRT2011900	hsa-miR-1297	CLIP-seq
MIRT2011901	hsa-miR-26a	CLIP-seq
MIRT2011902	hsa-miR-26b	CLIP-seq
MIRT2011903	hsa-miR-3591-3p	CLIP-seq
MIRT2011904	hsa-miR-3614-5p	CLIP-seq
MIRT1052540	hsa-miR-3674	CLIP-seq
MIRT2011905	hsa-miR-4465	CLIP-seq
MIRT1052566	hsa-miR-4703-3p	CLIP-seq
MIRT2244215	hsa-miR-223	CLIP-seq
MIRT2244216	hsa-miR-759	CLIP-seq
MIRT2244217	hsa-miR-888	CLIP-seq
MIRT2244218	hsa-miR-935	CLIP-seq
MIRT2429685	hsa-miR-19a	CLIP-seq
MIRT2429686	hsa-miR-19b	CLIP-seq
MIRT1052533	hsa-miR-3145-3p	CLIP-seq
MIRT1052541	hsa-miR-3689a-5p	CLIP-seq
MIRT1052542	hsa-miR-3689b	CLIP-seq
MIRT1052544	hsa-miR-3689e	CLIP-seq
MIRT1052545	hsa-miR-3689f	CLIP-seq
MIRT2547153	hsa-miR-1207-3p	CLIP-seq
MIRT2547154	hsa-miR-3171	CLIP-seq
MIRT2547155	hsa-miR-383	CLIP-seq
MIRT2547156	hsa-miR-3909	CLIP-seq
MIRT2547157	hsa-miR-4760-5p	CLIP-seq
MIRT2547158	hsa-miR-4772-5p	CLIP-seq
MIRT2547156	hsa-miR-3909	CLIP-seq
MIRT2547157	hsa-miR-4760-5p	CLIP-seq

Show/Hide all (45)

GO ID	Ontology	Definition	Evidence	Reference
GO:0003009	Process	Skeletal muscle contraction	IEA
GO:0005515	Function	Protein binding	IPI	16189514, 18218901, 19447967, 25416956, 28514442, 32296183, 32814053, 33961781, 35271311
GO:0005737	Component	Cytoplasm	IBA
GO:0005737	Component	Cytoplasm	IEA
GO:0005829	Component	Cytosol	IEA
GO:0005829	Component	Cytosol	TAS
GO:0005886	Component	Plasma membrane	IBA
GO:0005886	Component	Plasma membrane	IEA
GO:0007206	Process	Phospholipase C-activating G protein-coupled glutamate receptor signaling pathway	TAS	9808459
GO:0007216	Process	G protein-coupled glutamate receptor signaling pathway	IBA
GO:0007216	Process	G protein-coupled glutamate receptor signaling pathway	IEA
GO:0007268	Process	Chemical synaptic transmission	TAS	9808458
GO:0009967	Process	Positive regulation of signal transduction	IC	14505576
GO:0014069	Component	Postsynaptic density	IBA
GO:0014069	Component	Postsynaptic density	IEA
GO:0016020	Component	Membrane	IEA
GO:0030018	Component	Z disc	IEA
GO:0030424	Component	Axon	IEA
GO:0030425	Component	Dendrite	IBA
GO:0035256	Function	G protein-coupled glutamate receptor binding	IBA
GO:0035256	Function	G protein-coupled glutamate receptor binding	IEA
GO:0035591	Function	Signaling adaptor activity	IC	14505576
GO:0042995	Component	Cell projection	IEA
GO:0043005	Component	Neuron projection	IEA
GO:0043034	Component	Costamere	IEA
GO:0043197	Component	Dendritic spine	IEA
GO:0044309	Component	Neuron spine	ISS
GO:0044325	Function	Transmembrane transporter binding	IPI	14505576
GO:0045177	Component	Apical part of cell	IEA
GO:0045202	Component	Synapse	IEA
GO:0048148	Process	Behavioral response to cocaine	IEA
GO:0048741	Process	Skeletal muscle fiber development	IEA
GO:0051262	Process	Protein tetramerization	ISS
GO:0051592	Process	Response to calcium ion	IDA	14505576
GO:0051928	Process	Positive regulation of calcium ion transport	IEA
GO:0051966	Process	Regulation of synaptic transmission, glutamatergic	IBA
GO:0051966	Process	Regulation of synaptic transmission, glutamatergic	ISS
GO:0090279	Process	Regulation of calcium ion import	IEA
GO:0098794	Component	Postsynapse	IEA
GO:0098978	Component	Glutamatergic synapse	IEA
GO:0099524	Component	Postsynaptic cytosol	IEA
GO:1902950	Process	Regulation of dendritic spine maintenance	ISS
GO:2001256	Process	Regulation of store-operated calcium entry	IBA
GO:2001256	Process	Regulation of store-operated calcium entry	IEA
GO:2001256	Process	Regulation of store-operated calcium entry	TAS	14505576

MIM	HGNC	e!Ensembl
604798	17512	ENSG00000152413

Q86YM7

Protein name

Homer protein homolog 1 (Homer-1)

Protein function

Postsynaptic density scaffolding protein. Binds and cross-links cytoplasmic regions of GRM1, GRM5, ITPR1, DNM3, RYR1, RYR2, SHANK1 and SHANK3. By physically linking GRM1 and GRM5 with ER-associated ITPR1 receptors, it aids the coupling of surfac

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00568	WH1	1 → 107	WH1 domain	Domain

Sequence

MGEQPIFSTRAHVFQIDPNTKKNWVPTSKHAVTVSYFYDSTRNVYRIISLDGSKAIINST
ITPNMTFTKTSQKFGQWADSRANTVYGLGFSSEHHLSKFAEKFQEFKEAARLAKEKSQEK
MELTSTPSQESAGGDLQSPLTPESINGTDDERTPDVTQNSEPRAEPTQNALPFSHSSAIS
KHWEAELATLKGNNAKLTAALLESTANVKQWKQQLAAYQEEAERLHKRVTELECVSSQAN
AVHTHKTELNQTIQELEETLKLKEEEIERLKQEIDNARELQEQRDSLTQKLQEVEIRNKD
LEGQLSDLEQRLEKSQNEQEAFRNNLKTLLEILDGKIFELTELRDNLAKLLECS

Sequence length

354

Interactions

View interactions

	KEGG		Reactome
	FoxO signaling pathway Glutamatergic synapse		Neurexins and neuroligins

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (6)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
DEPRESSIVE DISORDER	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DYSKINESIA, DRUG-INDUCED	—	CTD, Disgenet CTD, Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MAJOR DEPRESSIVE DISORDER	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MENTAL DEPRESSION	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SCHIZOPHRENIA	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
UNIPOLAR DEPRESSION	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (58)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Alzheimer Disease	Alzheimer disease	Pubtator	32142100, 34502114, 36039594	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Amyotrophic Lateral Sclerosis	Amyotrophic Lateral Sclerosis	BEFREE	27999308		★★★★★ ★☆☆☆☆ Found in Text Mining only
Anhedonia	Anhedonia	BEFREE	31265863		★★★★★ ★☆☆☆☆ Found in Text Mining only
Anxiety	Anxiety Disorder	BEFREE	16011574		★★★★★ ★☆☆☆☆ Found in Text Mining only
Anxiety Disorders	Anxiety Disorder	BEFREE	16011574		★★★★★ ★☆☆☆☆ Found in Text Mining only
Atherosclerosis	Atherosclerosis	Pubtator	27832625	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Autistic Disorder	Autism	BEFREE	22558107		★★★★★ ★☆☆☆☆ Found in Text Mining only
Autistic Disorder	Autism	Pubtator	22558107	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Bipolar Disorder	Bipolar disorder	Pubtator	25956630	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Bipolar Disorder	Bipolar Disorder	BEFREE	29079138, 30178121		★★★★★ ★☆☆☆☆ Found in Text Mining only
Bipolar Disorder	Bipolar disorder	Pubtator	30178121	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	31790363, 40302343	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cerebral Infarction	Ischemic stroke	Pubtator	27832625	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cerebrovascular accident	Stroke	BEFREE	27832625		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cholangiocarcinoma	Cholangiocarcinoma	Pubtator	24815486	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cognition Disorders	Cognition disorder	Pubtator	36039594	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Coronary Artery Disease	Coronary artery disease	Pubtator	25551602	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Coronary Disease	Coronary artery disease	Pubtator	35546659	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Depressive disorder	Mental Depression	BEFREE	20673876, 26641965, 29550211, 31682853		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Depressive disorder	Mental Depression	PSYGENET_DG	20673876, 22072696, 22267161		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Depressive Disorder	Major depressive disorder	Pubtator	35665606	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Diabetes	Diabetes	BEFREE	27259299		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes Mellitus	BEFREE	27259299		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Non-Insulin-Dependent	Diabetes Mellitus	BEFREE	27259299		★★★★★ ★☆☆☆☆ Found in Text Mining only
Dyskinesia, Drug-Induced	Dyskinesia	CTD_human_DG	24126708		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Dyskinetic syndrome	Dyskinetic Syndrome	BEFREE	19648775, 28927418		★★★★★ ★☆☆☆☆ Found in Text Mining only
Epilepsy	Epilepsy	BEFREE	29222951		★★★★★ ★☆☆☆☆ Found in Text Mining only
Epilepsy	Epilepsy	Pubtator	35665606	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hallucinations	Hallucinations	CTD_human_DG	24126708		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hallucinations	Hallucinations	BEFREE	28927418		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hallucinations, Hypnapompic	Hallucinations	CTD_human_DG	24126708		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hallucinations, Somatic	Hallucinations	CTD_human_DG	24126708		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hemangioma	Hemangioma	BEFREE	12378015		★★★★★ ★☆☆☆☆ Found in Text Mining only
Huntington Disease	Huntington Disease	BEFREE	27818324		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypertensive disease	Hypertension	BEFREE	28664509		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypoxia	Hypoxia	Pubtator	33535171	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Intrahepatic Cholangiocarcinoma	Intrahepatic Cholangiocarcinoma	BEFREE	24815486		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ischemic stroke	Ischemic Stroke	BEFREE	27832625		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	29556326, 31790363		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic metastasis	Pubtator	24815486	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Major Depressive Disorder	Mental Depression	BEFREE	20673876, 27964944, 28815330		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Major Depressive Disorder	Mental Depression	PSYGENET_DG	20673876		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Mental Depression	Mental Depression	BEFREE	20673876, 26641965, 29550211, 31682853		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Mental Depression	Mental Depression	PSYGENET_DG	20673876, 22072696, 22267161		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Mental disorders	Mental Disorders	BEFREE	28815330		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mitochondrial Diseases	Mitochondrial disease	Pubtator	36039594	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Mood Disorders	Mood Disorder	BEFREE	29079138, 31265863		★★★★★ ★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Multiple myeloma	BEFREE	26718835		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	29556326		★★★★★ ★☆☆☆☆ Found in Text Mining only
Parkinson Disease	Parkinson disease	BEFREE	19648775, 24126708		★★★★★ ★☆☆☆☆ Found in Text Mining only
Schizophrenia	Schizophrenia	BEFREE	12815733, 16011574, 22749857, 24472577, 26555035, 28815330, 29022871, 29481317, 30282730		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Schizophrenia	Schizophrenia	LHGDN	12815733, 19165527		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Schizophrenia	Schizophrenia	PSYGENET_DG	12815733, 16011574, 16354916, 17317002		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Sleep Apnea Obstructive	Sleep apnea	Pubtator	32645048	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Sleep Deprivation	Sleep deprivation	Pubtator	32142100	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Unipolar Depression	Mental Depression	BEFREE	20673876, 28815330		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Unipolar Depression	Mental Depression	PSYGENET_DG	20673876		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Varicosity	Vulval varices	BEFREE	28337539		★★★★★ ★☆☆☆☆ Found in Text Mining only

HOMER1 (homer scaffold protein 1)