HOMER3 (homer scaffold protein 3)

Gene

• Entrez ID: 9454
• Gene name: Homer scaffold protein 3
• Gene symbol: HOMER3
• Synonyms (NCBI Gene): HOMER-3, VESL3
• Chromosome: 19
• Chromosome location: 19p13.11
• Summary: This gene encodes a member of the HOMER family of postsynaptic density scaffolding proteins that share a similar domain structure consisting of an N-terminal Enabled/vasodilator-stimulated phosphoprotein homology 1 domain which mediates protein-protein in

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT1052599	hsa-miR-1538	CLIP-seq
MIRT1052600	hsa-miR-1915	CLIP-seq
MIRT1052601	hsa-miR-3940-3p	CLIP-seq
MIRT1052602	hsa-miR-4685-5p	CLIP-seq
MIRT1052603	hsa-miR-4690-3p	CLIP-seq
MIRT1052604	hsa-miR-4745-3p	CLIP-seq
MIRT1052599	hsa-miR-1538	CLIP-seq
MIRT1052600	hsa-miR-1915	CLIP-seq
MIRT1052601	hsa-miR-3940-3p	CLIP-seq
MIRT1052602	hsa-miR-4685-5p	CLIP-seq
MIRT1052604	hsa-miR-4745-3p	CLIP-seq

Transcription factors

Transcription factor	Regulation	Reference
CEBPA	Unknown	14645007

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005515	Function	Protein binding	IPI	16189514, 16979624, 18218901, 18387811, 19060904, 19345194, 21516116, 21911467, 25416956, 25910212, 26871637, 29892012, 32296183, 33961781, 35271311
GO:0005737	Component	Cytoplasm	IBA
GO:0005737	Component	Cytoplasm	IEA
GO:0005829	Component	Cytosol	IEA
GO:0005829	Component	Cytosol	TAS
GO:0005886	Component	Plasma membrane	IBA
GO:0006605	Process	Protein targeting	TAS	10653696
GO:0007216	Process	G protein-coupled glutamate receptor signaling pathway	IBA
GO:0007216	Process	G protein-coupled glutamate receptor signaling pathway	IEA
GO:0007216	Process	G protein-coupled glutamate receptor signaling pathway	TAS	9808458
GO:0014069	Component	Postsynaptic density	IBA
GO:0014069	Component	Postsynaptic density	IEA
GO:0019904	Function	Protein domain specific binding	IEA
GO:0030425	Component	Dendrite	IBA
GO:0032703	Process	Negative regulation of interleukin-2 production	IMP	18218901
GO:0035256	Function	G protein-coupled glutamate receptor binding	IBA
GO:0035256	Function	G protein-coupled glutamate receptor binding	IEA
GO:0042802	Function	Identical protein binding	IPI	25416956, 31515488, 32296183
GO:0045178	Component	Basal part of cell	IEA
GO:0045202	Component	Synapse	IEA
GO:0051966	Process	Regulation of synaptic transmission, glutamatergic	IBA
GO:0070885	Process	Negative regulation of calcineurin-NFAT signaling cascade	IMP	18218901
GO:0098978	Component	Glutamatergic synapse	IEA
GO:2001256	Process	Regulation of store-operated calcium entry	IBA

Other IDs

• MIM: 604800
• HGNC: 17514
• e!Ensembl: ENSG00000051128

Protein

• UniProt ID: Q9NSC5
• Protein name: Homer protein homolog 3 (Homer-3)
• Protein function: Postsynaptic density scaffolding protein. Binds and cross-links cytoplasmic regions of GRM1, GRM5, ITPR1, DNM3, RYR1, RYR2, SHANK1 and SHANK3. By physically linking GRM1 and GRM5 with ER-associated ITPR1 receptors, it aids the coupling of surfac
• PDB: 2P8V, 3CVF
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00568	WH1	1 → 110	WH1 domain	Domain

• Sequence:

  MSTAREQPIFSTRAHVFQIDPATKRNWIPAGKHALTVSYFYDATRNVYRIISIGGAKAII
  NSTVTPNMTFTKTSQKFGQWADSRANTVYGLGFASEQHLTQFAEKFQEVKEAARLAREKS
  QDGGELTSPALGLASHQVPPSPLVSANGPGEEKLFRSQSADAPGPTERERLKKMLSEGSV
  GEVQWEAEFFALQDSNNKLAGALREANAAAAQWRQQLEAQRAEAERLRQRVAELEAQAAS
  EVTPTGEKEGLGQGQSLEQLEALVQTKDQEIQTLKSQTGGPREALEAAEREETQQKVQDL
  ETRNAELEHQLRAMERSLEEARAERERARAEVGRAAQLLDVSLFELSELREGLARLAEAA
  P

• Sequence length: 361

Pathways

KEGG:

FoxO signaling pathway
Glutamatergic synapse

Reactome:

Neurexins and neuroligins

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
CARCINOMA, ADENOID CYSTIC	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Keratoconus 5	Uncertain significance	ClinVar Disgenet	★★★☆☆ Reported in Unknown/Other Associations (≥2 sources)
SALIVARY GLAND NEOPLASMS	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Adenoid Cystic Carcinoma	Adenocarcinoma	CTD_human_DG	16762588		★☆☆☆☆ Found in Text Mining only
Cerebellar Diseases	Cerebellar Diseases	BEFREE	28306571		★☆☆☆☆ Found in Text Mining only
Depressive Disorder Major	Major depressive disorder	Pubtator	37511534	Associate	★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	Pubtator	33885248	Associate	★☆☆☆☆ Found in Text Mining only
Hypoxia	Hypoxia	Pubtator	34108014	Associate	★☆☆☆☆ Found in Text Mining only
Keratoconus	Keratoconus	Pubtator	39238827	Associate	★☆☆☆☆ Found in Text Mining only
Leukemia	Leukemia	Pubtator	23725168	Associate	★☆☆☆☆ Found in Text Mining only
Leukemia Myeloid Acute	Myeloid leukemia	Pubtator	23725168	Associate	★☆☆☆☆ Found in Text Mining only
Leukemia, Myelocytic, Acute	Leukemia	BEFREE	23725168		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of salivary gland	Malignant neoplasm of salivary gland	CTD_human_DG	16762588		★☆☆☆☆ Found in Text Mining only
Mood Disorders	Mood disorder	Pubtator	37511534	Associate	★☆☆☆☆ Found in Text Mining only
Salivary Gland Neoplasms	Salivary gland neoplasm	CTD_human_DG	16762588		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Urinary Bladder Neoplasms	Urinary bladder neoplasms	Pubtator	34108014	Associate	★☆☆☆☆ Found in Text Mining only