LY86 (lymphocyte antigen 86)

Gene

• Entrez ID: 9450
• Gene name: Lymphocyte antigen 86
• Gene symbol: LY86
• Synonyms (NCBI Gene): MD-1, MD1, MMD-1, dJ80N2.1
• Chromosome: 6
• Chromosome location: 6p25.1

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT1123049	hsa-miR-1207-3p	CLIP-seq
MIRT1123050	hsa-miR-28-5p	CLIP-seq
MIRT1123051	hsa-miR-3139	CLIP-seq
MIRT1123052	hsa-miR-3689d	CLIP-seq
MIRT1123053	hsa-miR-4279	CLIP-seq
MIRT1123054	hsa-miR-432	CLIP-seq
MIRT1123055	hsa-miR-4443	CLIP-seq
MIRT1123056	hsa-miR-4453	CLIP-seq
MIRT1123057	hsa-miR-4538	CLIP-seq
MIRT1123058	hsa-miR-4708-5p	CLIP-seq
MIRT1123059	hsa-miR-662	CLIP-seq
MIRT1123060	hsa-miR-708	CLIP-seq
MIRT1123049	hsa-miR-1207-3p	CLIP-seq
MIRT1123052	hsa-miR-3689d	CLIP-seq
MIRT1123054	hsa-miR-432	CLIP-seq
MIRT1123055	hsa-miR-4443	CLIP-seq
MIRT1123056	hsa-miR-4453	CLIP-seq
MIRT1123057	hsa-miR-4538	CLIP-seq
MIRT1123058	hsa-miR-4708-5p	CLIP-seq
MIRT1123059	hsa-miR-662	CLIP-seq
MIRT2265243	hsa-miR-181a	CLIP-seq
MIRT2265244	hsa-miR-181b	CLIP-seq
MIRT2265245	hsa-miR-181c	CLIP-seq
MIRT2265246	hsa-miR-181d	CLIP-seq
MIRT1123050	hsa-miR-28-5p	CLIP-seq
MIRT1123051	hsa-miR-3139	CLIP-seq
MIRT1123052	hsa-miR-3689d	CLIP-seq
MIRT2265247	hsa-miR-4262	CLIP-seq
MIRT1123054	hsa-miR-432	CLIP-seq
MIRT1123055	hsa-miR-4443	CLIP-seq
MIRT1123056	hsa-miR-4453	CLIP-seq
MIRT1123057	hsa-miR-4538	CLIP-seq
MIRT2265248	hsa-miR-4652-5p	CLIP-seq
MIRT1123058	hsa-miR-4708-5p	CLIP-seq
MIRT2265249	hsa-miR-542-5p	CLIP-seq
MIRT1123059	hsa-miR-662	CLIP-seq
MIRT1123060	hsa-miR-708	CLIP-seq

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0002376	Process	Immune system process	IEA
GO:0005515	Function	Protein binding	IPI	21857663, 32296183
GO:0005576	Component	Extracellular region	IEA
GO:0006954	Process	Inflammatory response	IEA
GO:0006955	Process	Immune response	IEA
GO:0031663	Process	Lipopolysaccharide-mediated signaling pathway	IEA
GO:0031666	Process	Positive regulation of lipopolysaccharide-mediated signaling pathway	IBA
GO:0031666	Process	Positive regulation of lipopolysaccharide-mediated signaling pathway	IEA
GO:0031666	Process	Positive regulation of lipopolysaccharide-mediated signaling pathway	IGI	10880523
GO:0045087	Process	Innate immune response	IBA
GO:0045087	Process	Innate immune response	IEA

Other IDs

• MIM: 605241
• HGNC: 16837
• e!Ensembl: ENSG00000112799

Protein

• UniProt ID: O95711
• Protein name: Lymphocyte antigen 86 (Ly-86) (Protein MD-1)
• Protein function: May cooperate with CD180 and TLR4 to mediate the innate immune response to bacterial lipopolysaccharide (LPS) and cytokine production. Important for efficient CD180 cell surface expression (By similarity).
• PDB: 3B2D
• Tissue specificity: TISSUE SPECIFICITY: Highly expressed in B-cells, monocytes and tonsil.
• Sequence:

  MKGFTATLFLWTLIFPSCSGGGGGKAWPTHVVCSDSGLEVLYQSCDPLQDFGFSVEKCSK
  QLKSNINIRFGIILREDIKELFLDLALMSQGSSVLNFSYPICEAALPKFSFCGRRKGEQI
  YYAGPVNNPEFTIPQGEYQVLLELYTEKRSTVACANATIMCS

• Sequence length: 162

Pathways

Reactome:

Toll Like Receptor 4 (TLR4) Cascade

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
BRAIN INJURIES	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CALCINOSIS	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CATARACT	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CENTRAL NERVOUS SYSTEM CANCER	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CHRONIC OBSTRUCTIVE PULMONARY DISEASE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
COLORECTAL CANCER	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ENDOMETRIAL CANCER	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ENDOMETRIAL CARCINOMA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ENDOMETRIAL NEOPLASM	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
GLIOBLASTOMA MULTIFORME	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
GLIOMA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
GOUT	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HEART VALVE DISEASE	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HEART VALVE DISEASES	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HEART VALVE PROLAPSE	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
JUVENILE DERMATOMYOSITIS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LIVER CIRRHOSIS, EXPERIMENTAL	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MAJOR DEPRESSIVE DISORDER	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OLIGODENDROGLIOMA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PELVIC ORGAN PROLAPSE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PSYCHIATRIC DISORDER	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
RECTUM CANCER	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TYPE 2 DIABETES MELLITUS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
VENOUS THROMBOEMBOLISM	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Alzheimer Disease	Alzheimer disease	Pubtator	31280115	Associate	★☆☆☆☆ Found in Text Mining only
Asthma	Asthma	BEFREE	19255686		★☆☆☆☆ Found in Text Mining only
Carotid Artery Diseases	Carotid artery disease	Pubtator	37861500	Associate	★☆☆☆☆ Found in Text Mining only
Colitis	Colitis	BEFREE	31104313		★☆☆☆☆ Found in Text Mining only
Diabetic Retinopathy	Diabetic retinopathy	Pubtator	37773794	Associate	★☆☆☆☆ Found in Text Mining only
Heart valve disease	Cardiac valvular disease	CTD_human_DG	21335463		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hyperplasia	Hyperplasia	Pubtator	35586138	Associate	★☆☆☆☆ Found in Text Mining only
Idiopathic generalized epilepsy	Epilepsy	BEFREE	18001295		★☆☆☆☆ Found in Text Mining only
Insulin Resistance	Diabetes mellitus, type 2	Pubtator	24735745	Associate	★☆☆☆☆ Found in Text Mining only
Necrosis	Necrosis	Pubtator	37861500	Associate	★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	BEFREE	24735745		★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	Pubtator	24735745, 37063877	Associate	★☆☆☆☆ Found in Text Mining only
Periodontitis	Periodontitis	Pubtator	37063877	Associate	★☆☆☆☆ Found in Text Mining only
Tumoral calcinosis	Tumoral Calcinosis	CTD_human_DG	21335463		★☆☆☆☆ Found in Text Mining only
Ulcerative Colitis	Ulcerative colitis	BEFREE	31104313		★☆☆☆☆ Found in Text Mining only
Venous Thromboembolism	Venous thromboembolism	Pubtator	21463476, 28203683	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations