Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene SNPs miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	9448
Gene name	Mitogen-activated protein kinase kinase kinase kinase 4
Gene symbol	MAP4K4
Synonyms (NCBI Gene)	FLH21957HEL-S-31HGKMEKKK4NIK
Chromosome	2
Chromosome location	2q11.2
Summary	The protein encoded by this gene is a member of the serine/threonine protein kinase family. This kinase has been shown to specifically activate MAPK8/JNK. The activation of MAPK8 by this kinase is found to be inhibited by the dominant-negative mutants of

Show/Hide all (1)

SNP ID	Visualize variation	Clinical significance	Consequence
rs781410462	G>A	Likely-pathogenic	Coding sequence variant, missense variant

347

Show/Hide all (347)

miRTarBase ID	miRNA	Experiments	Reference
MIRT052966	hsa-miR-520e	Luciferase reporter assayqRT-PCRWestern blot	22105365
MIRT053693	hsa-miR-181a-5p	Microarray	22942087
MIRT053751	hsa-miR-31-5p	ImmunoblotImmunohistochemistryLuciferase reporter assayqRT-PCR	22948084
MIRT437487	hsa-miR-141-3p	PANC-1	24013097
MIRT735663	hsa-miR-582-3p	Immunohistochemistry (IHC)	33510968
MIRT755629	rno-miR-547-3p	Luciferase reporter assayWestern blottingqRT-PCR	36045396
MIRT1129534	hsa-miR-1200	CLIP-seq
MIRT1129535	hsa-miR-1289	CLIP-seq
MIRT1129536	hsa-miR-139-3p	CLIP-seq
MIRT1129537	hsa-miR-299-3p	CLIP-seq
MIRT1129538	hsa-miR-300	CLIP-seq
MIRT1129539	hsa-miR-3074-5p	CLIP-seq
MIRT1129540	hsa-miR-3124-3p	CLIP-seq
MIRT1129541	hsa-miR-3176	CLIP-seq
MIRT1129542	hsa-miR-3187-3p	CLIP-seq
MIRT1129543	hsa-miR-3198	CLIP-seq
MIRT1129544	hsa-miR-3591-5p	CLIP-seq
MIRT1129545	hsa-miR-3649	CLIP-seq
MIRT1129546	hsa-miR-3663-5p	CLIP-seq
MIRT1129547	hsa-miR-370	CLIP-seq
MIRT1129548	hsa-miR-381	CLIP-seq
MIRT1129549	hsa-miR-3922-3p	CLIP-seq
MIRT1129550	hsa-miR-4277	CLIP-seq
MIRT1129551	hsa-miR-4280	CLIP-seq
MIRT1129552	hsa-miR-4294	CLIP-seq
MIRT1129553	hsa-miR-4309	CLIP-seq
MIRT1129554	hsa-miR-4318	CLIP-seq
MIRT1129555	hsa-miR-4324	CLIP-seq
MIRT1129556	hsa-miR-4329	CLIP-seq
MIRT1129557	hsa-miR-4435	CLIP-seq
MIRT1129558	hsa-miR-4466	CLIP-seq
MIRT1129559	hsa-miR-4491	CLIP-seq
MIRT1129560	hsa-miR-4494	CLIP-seq
MIRT1129561	hsa-miR-4504	CLIP-seq
MIRT1129562	hsa-miR-4520a-3p	CLIP-seq
MIRT1129563	hsa-miR-4528	CLIP-seq
MIRT1129564	hsa-miR-4529-5p	CLIP-seq
MIRT1129565	hsa-miR-4536	CLIP-seq
MIRT1129566	hsa-miR-4657	CLIP-seq
MIRT1129567	hsa-miR-4666-3p	CLIP-seq
MIRT1129568	hsa-miR-4682	CLIP-seq
MIRT1129569	hsa-miR-4684-3p	CLIP-seq
MIRT1129570	hsa-miR-4698	CLIP-seq
MIRT1129571	hsa-miR-4701-5p	CLIP-seq
MIRT1129572	hsa-miR-4763-5p	CLIP-seq
MIRT1129573	hsa-miR-4771	CLIP-seq
MIRT1129574	hsa-miR-4789-5p	CLIP-seq
MIRT1129575	hsa-miR-4802-3p	CLIP-seq
MIRT1129576	hsa-miR-501-5p	CLIP-seq
MIRT1129577	hsa-miR-542-3p	CLIP-seq
MIRT1129578	hsa-miR-544b	CLIP-seq
MIRT1129579	hsa-miR-548a-3p	CLIP-seq
MIRT1129580	hsa-miR-548e	CLIP-seq
MIRT1129581	hsa-miR-548f	CLIP-seq
MIRT1129582	hsa-miR-548n	CLIP-seq
MIRT1129583	hsa-miR-548s	CLIP-seq
MIRT1129584	hsa-miR-548t	CLIP-seq
MIRT1129585	hsa-miR-550a	CLIP-seq
MIRT1129586	hsa-miR-578	CLIP-seq
MIRT1129587	hsa-miR-581	CLIP-seq
MIRT1129588	hsa-miR-588	CLIP-seq
MIRT1129589	hsa-miR-675	CLIP-seq
MIRT1129590	hsa-miR-758	CLIP-seq
MIRT1129591	hsa-miR-933	CLIP-seq
MIRT1129592	hsa-miR-197	CLIP-seq
MIRT1129593	hsa-miR-3591-3p	CLIP-seq
MIRT1129594	hsa-miR-371b-3p	CLIP-seq
MIRT1129595	hsa-miR-759	CLIP-seq
MIRT1129596	hsa-miR-4762-5p	CLIP-seq
MIRT1129597	hsa-miR-4777-3p	CLIP-seq
MIRT1129598	hsa-miR-605	CLIP-seq
MIRT2036920	hsa-miR-1272	CLIP-seq
MIRT2036921	hsa-miR-1301	CLIP-seq
MIRT2036922	hsa-miR-1322	CLIP-seq
MIRT2036923	hsa-miR-145	CLIP-seq
MIRT2036924	hsa-miR-4659a-3p	CLIP-seq
MIRT2036925	hsa-miR-4659b-3p	CLIP-seq
MIRT2036926	hsa-miR-4660	CLIP-seq
MIRT2036927	hsa-miR-4756-3p	CLIP-seq
MIRT2036928	hsa-miR-5047	CLIP-seq
MIRT2036929	hsa-miR-548a-5p	CLIP-seq
MIRT2036930	hsa-miR-548ab	CLIP-seq
MIRT2036931	hsa-miR-548ak	CLIP-seq
MIRT2036932	hsa-miR-548b-5p	CLIP-seq
MIRT2036933	hsa-miR-548c-5p	CLIP-seq
MIRT2036934	hsa-miR-548d-5p	CLIP-seq
MIRT2036935	hsa-miR-548h	CLIP-seq
MIRT2036936	hsa-miR-548i	CLIP-seq
MIRT2036937	hsa-miR-548j	CLIP-seq
MIRT2036938	hsa-miR-548w	CLIP-seq
MIRT2036939	hsa-miR-548y	CLIP-seq
MIRT2036940	hsa-miR-559	CLIP-seq
MIRT2266984	hsa-miR-1181	CLIP-seq
MIRT2266985	hsa-miR-1206	CLIP-seq
MIRT2266986	hsa-miR-1226	CLIP-seq
MIRT2266987	hsa-miR-1250	CLIP-seq
MIRT2036920	hsa-miR-1272	CLIP-seq
MIRT2036921	hsa-miR-1301	CLIP-seq
MIRT2036922	hsa-miR-1322	CLIP-seq
MIRT2266988	hsa-miR-1324	CLIP-seq
MIRT2036923	hsa-miR-145	CLIP-seq
MIRT2266989	hsa-miR-200b	CLIP-seq
MIRT2266990	hsa-miR-200c	CLIP-seq
MIRT2266991	hsa-miR-29a	CLIP-seq
MIRT2266992	hsa-miR-29b	CLIP-seq
MIRT2266993	hsa-miR-29c	CLIP-seq
MIRT2266994	hsa-miR-3065-3p	CLIP-seq
MIRT2266995	hsa-miR-3125	CLIP-seq
MIRT2266996	hsa-miR-3157-3p	CLIP-seq
MIRT2266997	hsa-miR-3160-5p	CLIP-seq
MIRT2266998	hsa-miR-3173-3p	CLIP-seq
MIRT1129541	hsa-miR-3176	CLIP-seq
MIRT2266999	hsa-miR-3180-5p	CLIP-seq
MIRT1129542	hsa-miR-3187-3p	CLIP-seq
MIRT2267000	hsa-miR-3529	CLIP-seq
MIRT2267001	hsa-miR-3612	CLIP-seq
MIRT2267002	hsa-miR-3617	CLIP-seq
MIRT2267003	hsa-miR-3622a-3p	CLIP-seq
MIRT2267004	hsa-miR-3622b-3p	CLIP-seq
MIRT2267005	hsa-miR-379	CLIP-seq
MIRT2267006	hsa-miR-3916	CLIP-seq
MIRT1129549	hsa-miR-3922-3p	CLIP-seq
MIRT2267007	hsa-miR-3944-5p	CLIP-seq
MIRT2267008	hsa-miR-4252	CLIP-seq
MIRT2267009	hsa-miR-429	CLIP-seq
MIRT2267010	hsa-miR-4290	CLIP-seq
MIRT2267011	hsa-miR-4304	CLIP-seq
MIRT2267012	hsa-miR-4420	CLIP-seq
MIRT2267013	hsa-miR-4432	CLIP-seq
MIRT2267014	hsa-miR-4443	CLIP-seq
MIRT2267015	hsa-miR-4451	CLIP-seq
MIRT2267016	hsa-miR-4522	CLIP-seq
MIRT2267017	hsa-miR-4539	CLIP-seq
MIRT2267018	hsa-miR-4633-3p	CLIP-seq
MIRT2267019	hsa-miR-4635	CLIP-seq
MIRT2267020	hsa-miR-4650-3p	CLIP-seq
MIRT2036924	hsa-miR-4659a-3p	CLIP-seq
MIRT2036925	hsa-miR-4659b-3p	CLIP-seq
MIRT2036926	hsa-miR-4660	CLIP-seq
MIRT2267021	hsa-miR-4709-3p	CLIP-seq
MIRT2267022	hsa-miR-4711-5p	CLIP-seq
MIRT2267023	hsa-miR-4712-5p	CLIP-seq
MIRT2267024	hsa-miR-4774-5p	CLIP-seq
MIRT2267025	hsa-miR-4779	CLIP-seq
MIRT1129574	hsa-miR-4789-5p	CLIP-seq
MIRT2036928	hsa-miR-5047	CLIP-seq
MIRT2267026	hsa-miR-516b	CLIP-seq
MIRT2036929	hsa-miR-548a-5p	CLIP-seq
MIRT2036930	hsa-miR-548ab	CLIP-seq
MIRT2036931	hsa-miR-548ak	CLIP-seq
MIRT2036932	hsa-miR-548b-5p	CLIP-seq
MIRT2036933	hsa-miR-548c-5p	CLIP-seq
MIRT2036934	hsa-miR-548d-5p	CLIP-seq
MIRT2036935	hsa-miR-548h	CLIP-seq
MIRT2036936	hsa-miR-548i	CLIP-seq
MIRT2036937	hsa-miR-548j	CLIP-seq
MIRT2036938	hsa-miR-548w	CLIP-seq
MIRT2036939	hsa-miR-548y	CLIP-seq
MIRT2036940	hsa-miR-559	CLIP-seq
MIRT2267027	hsa-miR-609	CLIP-seq
MIRT2267028	hsa-miR-615-3p	CLIP-seq
MIRT2267029	hsa-miR-641	CLIP-seq
MIRT2267030	hsa-miR-650	CLIP-seq
MIRT2267031	hsa-miR-770-5p	CLIP-seq
MIRT2267032	hsa-miR-874	CLIP-seq
MIRT2390587	hsa-miR-4709-5p	CLIP-seq
MIRT2036921	hsa-miR-1301	CLIP-seq
MIRT2036926	hsa-miR-4660	CLIP-seq
MIRT2036928	hsa-miR-5047	CLIP-seq
MIRT2267018	hsa-miR-4633-3p	CLIP-seq
MIRT2453694	hsa-miR-1229	CLIP-seq
MIRT2453695	hsa-miR-3919	CLIP-seq
MIRT2036927	hsa-miR-4756-3p	CLIP-seq
MIRT2453696	hsa-miR-4797-5p	CLIP-seq
MIRT2566598	hsa-miR-1224-3p	CLIP-seq
MIRT2566599	hsa-miR-1252	CLIP-seq
MIRT2566600	hsa-miR-1261	CLIP-seq
MIRT2566601	hsa-miR-1264	CLIP-seq
MIRT2566602	hsa-miR-1293	CLIP-seq
MIRT2566603	hsa-miR-1297	CLIP-seq
MIRT2036921	hsa-miR-1301	CLIP-seq
MIRT2266988	hsa-miR-1324	CLIP-seq
MIRT1129536	hsa-miR-139-3p	CLIP-seq
MIRT2566604	hsa-miR-142-5p	CLIP-seq
MIRT2566605	hsa-miR-150	CLIP-seq
MIRT2566606	hsa-miR-155	CLIP-seq
MIRT2566607	hsa-miR-182	CLIP-seq
MIRT2566608	hsa-miR-1913	CLIP-seq
MIRT2566609	hsa-miR-1914	CLIP-seq
MIRT2566610	hsa-miR-208a	CLIP-seq
MIRT2566611	hsa-miR-208b	CLIP-seq
MIRT2566612	hsa-miR-2117	CLIP-seq
MIRT2566613	hsa-miR-2355-5p	CLIP-seq
MIRT2566614	hsa-miR-2467-3p	CLIP-seq
MIRT2566615	hsa-miR-2467-5p	CLIP-seq
MIRT2566616	hsa-miR-26a	CLIP-seq
MIRT2566617	hsa-miR-26b	CLIP-seq
MIRT2566618	hsa-miR-299-5p	CLIP-seq
MIRT1129538	hsa-miR-300	CLIP-seq
MIRT2566619	hsa-miR-3064-3p	CLIP-seq
MIRT2566620	hsa-miR-3121-5p	CLIP-seq
MIRT2566621	hsa-miR-3148	CLIP-seq
MIRT2566622	hsa-miR-3149	CLIP-seq
MIRT2566623	hsa-miR-3156-3p	CLIP-seq
MIRT1129541	hsa-miR-3176	CLIP-seq
MIRT1129542	hsa-miR-3187-3p	CLIP-seq
MIRT2566624	hsa-miR-3188	CLIP-seq
MIRT2566625	hsa-miR-324-3p	CLIP-seq
MIRT2566626	hsa-miR-338-5p	CLIP-seq
MIRT2566627	hsa-miR-361-3p	CLIP-seq
MIRT2267002	hsa-miR-3617	CLIP-seq
MIRT2566628	hsa-miR-362-5p	CLIP-seq
MIRT2566629	hsa-miR-3647-3p	CLIP-seq
MIRT2566630	hsa-miR-3653	CLIP-seq
MIRT2566631	hsa-miR-3658	CLIP-seq
MIRT1129546	hsa-miR-3663-5p	CLIP-seq
MIRT2566632	hsa-miR-3667-5p	CLIP-seq
MIRT2566633	hsa-miR-3682-5p	CLIP-seq
MIRT2566634	hsa-miR-374a	CLIP-seq
MIRT2566635	hsa-miR-374b	CLIP-seq
MIRT2566636	hsa-miR-375	CLIP-seq
MIRT1129548	hsa-miR-381	CLIP-seq
MIRT1129549	hsa-miR-3922-3p	CLIP-seq
MIRT2566637	hsa-miR-3943	CLIP-seq
MIRT2566638	hsa-miR-3975	CLIP-seq
MIRT2566639	hsa-miR-409-3p	CLIP-seq
MIRT2566640	hsa-miR-4273	CLIP-seq
MIRT2566641	hsa-miR-4282	CLIP-seq
MIRT2566642	hsa-miR-4297	CLIP-seq
MIRT2566643	hsa-miR-4300	CLIP-seq
MIRT2566644	hsa-miR-4301	CLIP-seq
MIRT2566645	hsa-miR-4316	CLIP-seq
MIRT2566646	hsa-miR-4422	CLIP-seq
MIRT2566647	hsa-miR-4465	CLIP-seq
MIRT2566648	hsa-miR-4468	CLIP-seq
MIRT2566649	hsa-miR-4470	CLIP-seq
MIRT2566650	hsa-miR-4477a	CLIP-seq
MIRT2566651	hsa-miR-4480	CLIP-seq
MIRT2566652	hsa-miR-4481	CLIP-seq
MIRT2566653	hsa-miR-4483	CLIP-seq
MIRT2566654	hsa-miR-4511	CLIP-seq
MIRT2566655	hsa-miR-452	CLIP-seq
MIRT1129563	hsa-miR-4528	CLIP-seq
MIRT1129564	hsa-miR-4529-5p	CLIP-seq
MIRT2566656	hsa-miR-4533	CLIP-seq
MIRT2267018	hsa-miR-4633-3p	CLIP-seq
MIRT2566657	hsa-miR-4633-5p	CLIP-seq
MIRT2566658	hsa-miR-4654	CLIP-seq
MIRT2566659	hsa-miR-4658	CLIP-seq
MIRT2036924	hsa-miR-4659a-3p	CLIP-seq
MIRT2036925	hsa-miR-4659b-3p	CLIP-seq
MIRT2036926	hsa-miR-4660	CLIP-seq
MIRT1129567	hsa-miR-4666-3p	CLIP-seq
MIRT2566660	hsa-miR-4668-3p	CLIP-seq
MIRT2566661	hsa-miR-4668-5p	CLIP-seq
MIRT2566662	hsa-miR-4676-3p	CLIP-seq
MIRT2566663	hsa-miR-4677-5p	CLIP-seq
MIRT2566664	hsa-miR-4681	CLIP-seq
MIRT2566665	hsa-miR-4693-5p	CLIP-seq
MIRT1129570	hsa-miR-4698	CLIP-seq
MIRT2566666	hsa-miR-4700-3p	CLIP-seq
MIRT2566667	hsa-miR-4710	CLIP-seq
MIRT2267022	hsa-miR-4711-5p	CLIP-seq
MIRT2566668	hsa-miR-4713-5p	CLIP-seq
MIRT2566669	hsa-miR-4715-3p	CLIP-seq
MIRT2566670	hsa-miR-4729	CLIP-seq
MIRT2566671	hsa-miR-4745-5p	CLIP-seq
MIRT2566672	hsa-miR-4747-5p	CLIP-seq
MIRT2566673	hsa-miR-4758-5p	CLIP-seq
MIRT2566674	hsa-miR-4765	CLIP-seq
MIRT2566675	hsa-miR-4766-3p	CLIP-seq
MIRT2566676	hsa-miR-4769-5p	CLIP-seq
MIRT2566677	hsa-miR-4778-3p	CLIP-seq
MIRT2566678	hsa-miR-4786-3p	CLIP-seq
MIRT1129574	hsa-miR-4789-5p	CLIP-seq
MIRT1129575	hsa-miR-4802-3p	CLIP-seq
MIRT2566679	hsa-miR-483-5p	CLIP-seq
MIRT2566680	hsa-miR-485-5p	CLIP-seq
MIRT2566681	hsa-miR-494	CLIP-seq
MIRT2566682	hsa-miR-499-5p	CLIP-seq
MIRT2566683	hsa-miR-500b	CLIP-seq
MIRT1129576	hsa-miR-501-5p	CLIP-seq
MIRT2036928	hsa-miR-5047	CLIP-seq
MIRT2566684	hsa-miR-5096	CLIP-seq
MIRT2566685	hsa-miR-513a-3p	CLIP-seq
MIRT2566686	hsa-miR-513b	CLIP-seq
MIRT2566687	hsa-miR-513c	CLIP-seq
MIRT2566688	hsa-miR-514b-5p	CLIP-seq
MIRT2566689	hsa-miR-515-5p	CLIP-seq
MIRT2566690	hsa-miR-520d-5p	CLIP-seq
MIRT2566691	hsa-miR-524-5p	CLIP-seq
MIRT2566692	hsa-miR-532-3p	CLIP-seq
MIRT2036929	hsa-miR-548a-5p	CLIP-seq
MIRT2036930	hsa-miR-548ab	CLIP-seq
MIRT2036931	hsa-miR-548ak	CLIP-seq
MIRT2566693	hsa-miR-548b-3p	CLIP-seq
MIRT2036932	hsa-miR-548b-5p	CLIP-seq
MIRT2036933	hsa-miR-548c-5p	CLIP-seq
MIRT2036934	hsa-miR-548d-5p	CLIP-seq
MIRT2036935	hsa-miR-548h	CLIP-seq
MIRT2036936	hsa-miR-548i	CLIP-seq
MIRT2036937	hsa-miR-548j	CLIP-seq
MIRT2566694	hsa-miR-548k	CLIP-seq
MIRT2566695	hsa-miR-548l	CLIP-seq
MIRT1129582	hsa-miR-548n	CLIP-seq
MIRT2566696	hsa-miR-548p	CLIP-seq
MIRT1129584	hsa-miR-548t	CLIP-seq
MIRT2036938	hsa-miR-548w	CLIP-seq
MIRT2036939	hsa-miR-548y	CLIP-seq
MIRT1129585	hsa-miR-550a	CLIP-seq
MIRT2566697	hsa-miR-556-3p	CLIP-seq
MIRT2036940	hsa-miR-559	CLIP-seq
MIRT2566698	hsa-miR-579	CLIP-seq
MIRT2566699	hsa-miR-586	CLIP-seq
MIRT2566700	hsa-miR-587	CLIP-seq
MIRT2566701	hsa-miR-591	CLIP-seq
MIRT2566702	hsa-miR-604	CLIP-seq
MIRT1129598	hsa-miR-605	CLIP-seq
MIRT2566703	hsa-miR-616	CLIP-seq
MIRT2566704	hsa-miR-622	CLIP-seq
MIRT2267029	hsa-miR-641	CLIP-seq
MIRT2566705	hsa-miR-647	CLIP-seq
MIRT2566706	hsa-miR-664	CLIP-seq
MIRT2566707	hsa-miR-671-5p	CLIP-seq
MIRT1129595	hsa-miR-759	CLIP-seq
MIRT2566708	hsa-miR-889	CLIP-seq
MIRT2566709	hsa-miR-9	CLIP-seq
MIRT2566710	hsa-miR-920	CLIP-seq
MIRT2267002	hsa-miR-3617	CLIP-seq
MIRT2267029	hsa-miR-641	CLIP-seq
MIRT2267002	hsa-miR-3617	CLIP-seq
MIRT2267018	hsa-miR-4633-3p	CLIP-seq
MIRT2036929	hsa-miR-548a-5p	CLIP-seq
MIRT2036930	hsa-miR-548ab	CLIP-seq
MIRT2036931	hsa-miR-548ak	CLIP-seq
MIRT2036932	hsa-miR-548b-5p	CLIP-seq
MIRT2036933	hsa-miR-548c-5p	CLIP-seq
MIRT2036934	hsa-miR-548d-5p	CLIP-seq
MIRT2036935	hsa-miR-548h	CLIP-seq
MIRT2036936	hsa-miR-548i	CLIP-seq
MIRT2036937	hsa-miR-548j	CLIP-seq
MIRT2036938	hsa-miR-548w	CLIP-seq
MIRT2036939	hsa-miR-548y	CLIP-seq
MIRT2036940	hsa-miR-559	CLIP-seq
MIRT2267029	hsa-miR-641	CLIP-seq
MIRT2267002	hsa-miR-3617	CLIP-seq
MIRT2267029	hsa-miR-641	CLIP-seq

Show/Hide all (37)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000165	Process	MAPK cascade	IBA
GO:0000166	Function	Nucleotide binding	IEA
GO:0001953	Process	Negative regulation of cell-matrix adhesion	NAS	25490267
GO:0004111	Function	Creatine kinase activity	IDA	23207904
GO:0004672	Function	Protein kinase activity	IEA
GO:0004674	Function	Protein serine/threonine kinase activity	IBA
GO:0004674	Function	Protein serine/threonine kinase activity	IDA	9890973
GO:0004674	Function	Protein serine/threonine kinase activity	IEA
GO:0005515	Function	Protein binding	IPI	12387898, 14966141, 25852190, 29961565, 32707033, 33961781
GO:0005524	Function	ATP binding	IDA	9890973
GO:0005524	Function	ATP binding	IEA
GO:0005737	Component	Cytoplasm	IBA
GO:0005737	Component	Cytoplasm	IDA	26437443
GO:0005737	Component	Cytoplasm	IDA	14966141
GO:0005737	Component	Cytoplasm	IEA
GO:0005925	Component	Focal adhesion	IDA	25490267
GO:0006468	Process	Protein phosphorylation	IDA	9890973
GO:0008017	Function	Microtubule binding	IDA	25490267
GO:0008349	Function	MAP kinase kinase kinase kinase activity	IDA	26437443
GO:0016301	Function	Kinase activity	IEA
GO:0016740	Function	Transferase activity	IEA
GO:0030335	Process	Positive regulation of cell migration	IMP	24163766
GO:0032014	Process	Positive regulation of ARF protein signal transduction	ISS	25490267
GO:0035329	Process	Hippo signaling	IDA	35429439
GO:0035332	Process	Positive regulation of hippo signaling	IDA	26437443
GO:0035556	Process	Intracellular signal transduction	IDA	9890973
GO:0035556	Process	Intracellular signal transduction	IEA
GO:0043066	Process	Negative regulation of apoptotic process	IMP	21196414
GO:0043408	Process	Regulation of MAPK cascade	IBA
GO:0046328	Process	Regulation of JNK cascade	IDA	14966141
GO:0046328	Process	Regulation of JNK cascade	IEA
GO:0048812	Process	Neuron projection morphogenesis	IBA
GO:0051549	Process	Positive regulation of keratinocyte migration	ISS	25490267
GO:0051894	Process	Positive regulation of focal adhesion assembly	ISS	25490267
GO:0106310	Function	Protein serine kinase activity	IEA
GO:0120183	Process	Positive regulation of focal adhesion disassembly	ISS	25490267
GO:1902533	Process	Positive regulation of intracellular signal transduction	IEA

MIM	HGNC	e!Ensembl
604666	6866	ENSG00000071054

O95819

Protein name

Mitogen-activated protein kinase kinase kinase kinase 4 (EC 2.7.11.1) (HPK/GCK-like kinase HGK) (MAPK/ERK kinase kinase kinase 4) (MEK kinase kinase 4) (MEKKK 4) (Nck-interacting kinase)

Protein function

Serine/threonine kinase that plays a role in the response to environmental stress and cytokines such as TNF-alpha. Appears to act upstream of the JUN N-terminal pathway (PubMed:9890973). Activator of the Hippo signaling pathway which plays a piv

PDB

4OBO , 4OBP , 4OBQ , 4RVT , 4U3Y , 4U3Z , 4U40 , 4U41 , 4U42 , 4U43 , 4U44 , 4U45 , 4ZK5 , 4ZP5 , 5DI1 , 5J95 , 5W5Q , 8V5I

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00069	Pkinase	25 → 289	Protein kinase domain	Domain
PF00780	CNH	930 → 1210	CNH domain	Family

Tissue specificity

TISSUE SPECIFICITY: Widely expressed. Isoform 5 is abundant in the brain. Isoform 4 is predominant in the liver, skeletal muscle and placenta. {ECO:0000269|PubMed:9890973}.

Sequence

MANDSPAKSLVDIDLSSLRDPAGIFELVEVVGNGTYGQVYKGRHVKTGQLAAIKVMDVTE
DEEEEIKLEINMLKKYSHHRNIATYYGAFIKKSPPGHDDQLWLVMEFCGAGSITDLVKNT
KGNTLKEDWIAYISREILRGLAHLHIHHVIHRDIKGQNVLLTENAEVKLVDFGVSAQLDR
TVGRRNTFIGTPYWMAPEVIACDENPDATYDYRSDLWSCGITAIEMAEGAPPLCDMHPMR
ALFLIPRNPPPRLKSKKWSKKFFSFIEGCLVKNYMQRPSTEQLLKHPFIRDQPNERQVRI
QLKDHIDRTRKKRGEKDETEYEYSGSEEEEEEVPEQEGEPSSIVNVPGESTLRRDFLRLQ
QENKERSEALRRQQLLQEQQLREQEEYKRQLLAERQKRIEQQKEQRRRLEEQQRREREAR
RQQEREQRRREQEEKRRLEELERRRKEEEERRRAEEEKRRVEREQEYIRRQLEEEQRHLE
VLQQQLLQEQAMLLECRWREMEEHRQAERLQRQLQQEQAYLLSLQHDHRRPHPQHSQQPP
PPQQERSKPSFHAPEPKAHYEPADRAREVEDRFRKTNHSSPEAQSKQTGRVLEPPVPSRS
ESFSNGNSESVHPALQRPAEPQVPVRTTSRSPVLSRRDSPLQGSGQQNSQAGQRNSTSIE
PRLLWERVEKLVPRPGSGSSSGSSNSGSQPGSHPGSQSGSGERFRVRSSSKSEGSPSQRL
ENAVKKPEDKKEVFRPLKPADLTALAKELRAVEDVRPPHKVTDYSSSSEESGTTDEEDDD
VEQEGADESTSGPEDTRAASSLNLSNGETESVKTMIVHDDVESEPAMTPSKEGTLIVRQT
QSASSTLQKHKSSSSFTPFIDPRLLQISPSSGTTVTSVVGFSCDGMRPEAIRQDPTRKGS
VVNVNPTNTRPQSDTPEIRKYKKRFNSEILCAALWGVNLLVGTESGLMLLDRSGQGKVYP
LINRRRFQQMDVLEGLNVLVTISGKKDKLRVYYLSWLRNKILHNDPEVEKKQGWTTVGDL
EGCVHYKVVKYERIKFLVIALKSSVEVYAWAPKPYHKFMAFKSFGELVHKPLLVDLTVEE
GQRLKVIYGSCAGFHAVDVDSGSVYDIYLPTHIQCSIKPHAIIILPNTDGMELLVCYEDE
GVYVNTYGRITKDVVLQWGEMPTSVAYIRSNQTMGWGEKAIEIRSVETGHLDGVFMHKRA
QRLKFLCERNDKVFFASVRSGGSSQVYFMTLGRTSLLSW

Sequence length

1239

Interactions

View interactions

	KEGG		Reactome
	MAPK signaling pathway		Oxidative Stress Induced Senescence

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Causal Diseases (3)

Phenotype Name	Clinical Significance	dbSNP ID	RCV Accession	Evidence Score
Causal Diseases associated with Pathogenic or Likely Pathogenic variants in ClinVar
Cerebral arteriovenous malformation	Likely pathogenic	rs781410462	RCV000656330	★★★★★ ★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Imperforate anus	Likely pathogenic	rs2468868556	RCV002468742	★★★★★ ★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Renal dysplasia	Likely pathogenic	rs2468868556	RCV002468742	★★★★★ ★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)

Show/Hide Unknown Diseases (21)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
Acute myeloid leukemia	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ALZHEIMER DISEASE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ANUS, IMPERFORATE	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ARTERIOVENOUS MALFORMATIONS, CEREBRAL	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ASTHMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ATOPIC ASTHMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BREAST CANCER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BREAST CARCINOMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Cervical cancer	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CHILDHOOD ONSET ASTHMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Cholangiocarcinoma	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
COMPLEX NEURODEVELOPMENTAL DISORDER	—	HPO	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CROHN'S DISEASE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
INFLAMMATORY BOWEL DISEASE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LUNG NEOPLASMS	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Malignant tumor of esophagus	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
NON-SPECIFIC SYNDROMIC INTELLECTUAL DISABILITY	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PARKINSON DISEASE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Sarcoma	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ULCERATIVE COLITIS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Uterine corpus endometrial carcinoma	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (92)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Adenocarcinoma of lung (disorder)	Lung adenocarcinoma	BEFREE	22824148, 28306189		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adult Medulloblastoma	Medulloblastoma	BEFREE	29796184		★★★★★ ★☆☆☆☆ Found in Text Mining only
Amyotrophic Lateral Sclerosis	Amyotrophic Lateral Sclerosis	BEFREE	30699345		★★★★★ ★☆☆☆☆ Found in Text Mining only
ANOPHTHALMIA AND PULMONARY HYPOPLASIA	Syndromic microphthalmia	BEFREE	29970191		★★★★★ ★☆☆☆☆ Found in Text Mining only
Arteriosclerosis	Arteriosclerosis	BEFREE	24626634, 27044870, 27160798, 28611026		★★★★★ ★☆☆☆☆ Found in Text Mining only
Asthma	Asthma	GWASCAT_DG	27130862		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Atherosclerosis	Atherosclerosis	BEFREE	24626634, 27044870, 27160798, 28611026		★★★★★ ★☆☆☆☆ Found in Text Mining only
Autism Spectrum Disorder	Autism	Pubtator	36469137	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Azoospermia	Azoospermia	Pubtator	36497065	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Benign Prostatic Hyperplasia	Benign Prostatic Hyperplasia	BEFREE	24474452		★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	26513020, 27876836, 29620289		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Breast Neoplasms	Breast neoplasm	Pubtator	25148458, 37312710	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinogenesis	Carcinogenesis	Pubtator	26269113	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	20857524	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma of larynx	Laryngeal carcinoma	BEFREE	26001828		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cardiomyopathies	Cardiomyopathy	Pubtator	32694738	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cardiovascular Diseases	Cardiovascular Diseases	BEFREE	27160798		★★★★★ ★☆☆☆☆ Found in Text Mining only
cervical cancer	Cervical Cancer	BEFREE	29461619		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Cervix carcinoma	Cervix carcinoma	BEFREE	29461619		★★★★★ ★☆☆☆☆ Found in Text Mining only
Childhood Medulloblastoma	Medulloblastoma	BEFREE	29796184		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	29138007, 30429233		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	26499327, 29138007, 30361904	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Developmental Disabilities	Developmental disability	Pubtator	36469137	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes	Diabetes	BEFREE	29570292		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes mellitus	Pubtator	23094072, 27174326	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes Mellitus	BEFREE	29570292		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus Type 2	Diabetes mellitus, type 2	Pubtator	23094072, 26918832, 27174326, 32993798	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Non-Insulin-Dependent	Diabetes Mellitus	BEFREE	19690174, 26791862, 26918832, 27174326, 28061846		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diffuse Large B-Cell Lymphoma	Diffuse Lymphoma	BEFREE	20889926		★★★★★ ★☆☆☆☆ Found in Text Mining only
Esophageal carcinoma	Esophageal Carcinoma	BEFREE	31516617		★★★★★ ★☆☆☆☆ Found in Text Mining only
Esophageal Neoplasms	Esophagus Neoplasm	BEFREE	31516617		★★★★★ ★☆☆☆☆ Found in Text Mining only
Fatty Liver	Fatty liver	Pubtator	35679904	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Fatty Liver Alcoholic	Fatty liver, alcoholic	Pubtator	35679904	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Focal Cortical Dysplasia	Focal cortical dysplasia	Pubtator	34301297	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Focal cortical dysplasia of Taylor	Focal cortical dysplasia	Pubtator	34301297	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Frontotemporal dementia	Frontotemporal dementia	BEFREE	9799091		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	BEFREE	31570734		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	Pubtator	31570734	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma Multiforme	Glioblastoma	BEFREE	31570734		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	Pubtator	31570734	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Heart Diseases	Heart disease	Pubtator	32694738	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hyperglycemia	Hyperglycemia	BEFREE	27160798		★★★★★ ★☆☆☆☆ Found in Text Mining only
Infertility Male	Male infertility	Pubtator	36497065	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Insulin Resistance	Diabetes mellitus, type 2	Pubtator	17227768, 23094072, 27174326	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Kaposi Sarcoma	Kaposi Sarcoma	BEFREE	24244164, 26197270		★★★★★ ★☆☆☆☆ Found in Text Mining only
LEPTIN RECEPTOR DEFICIENCY	LEPTIN RECEPTOR DEFICIENCY	BEFREE	25098764		★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia Myeloid Acute	Myeloid leukemia	Pubtator	31522654	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	21196414, 26722431, 27010469		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung Neoplasms	CTD_human_DG	27935865		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Lymphoma	Lymphoma	BEFREE	24362935		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphopenia	Lymphopenia	BEFREE	25406581		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	26513020, 27876836, 29620289		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of esophagus	Esophagus Neoplasm	BEFREE	31516617		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of larynx	Larynx cancer	BEFREE	26001828		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of lung	Lung Cancer	CTD_human_DG	27935865		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of pancreas	Pancreatic cancer	BEFREE	24013097		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	BEFREE	31241916		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of stomach	Stomach Neoplasms	BEFREE	26549737		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of thyroid	Thyroid cancer	BEFREE	28855631		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	11510478, 21196414, 22824148, 25704885		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant tumor of cervix	Cervical Tumor	BEFREE	29461619		★★★★★ ★☆☆☆☆ Found in Text Mining only
Medulloblastoma	Medulloblastoma	BEFREE	29796184		★★★★★ ★☆☆☆☆ Found in Text Mining only
Motor neuron atrophy	Motor neuron atrophy	BEFREE	30699345		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	12612079, 21196414, 24013097, 25250919, 26467022, 28591712, 29796184, 29970191, 30089311, 31243669		★★★★★ ★☆☆☆☆ Found in Text Mining only
Non-Small Cell Lung Carcinoma	Lung carcinoma	BEFREE	31586084		★★★★★ ★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	Pubtator	19351711	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	Pubtator	26918832	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	BEFREE	28611026		★★★★★ ★☆☆☆☆ Found in Text Mining only
Oestrogen receptor positive breast cancer	Oestrogen Receptor Positive Breast Cancer	BEFREE	25148458		★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteoporosis	Osteoporosis	Pubtator	25148458	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Ovarian neoplasm	Pubtator	36922678	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatic carcinoma	Pancreatic carcinoma	BEFREE	24013097		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasms	Pancreatic neoplasm	Pubtator	26269113, 30710069	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Parkinson Disease	Parkinson disease	GWASCAT_DG	28892059		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Peritonitis	Peritonitis	Pubtator	36922678	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Pick Disease of the Brain	Pica	BEFREE	9799091		★★★★★ ★☆☆☆☆ Found in Text Mining only
Primary immune deficiency disorder	immunodeficiency	BEFREE	25406581		★★★★★ ★☆☆☆☆ Found in Text Mining only
Progressive supranuclear palsy	Progressive Supranuclear Palsy	BEFREE	12668260		★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostate carcinoma	Prostate cancer	BEFREE	31241916		★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostatic Hyperplasia	Prostatic hyperplasia	Pubtator	24474452	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	31241916, 34112843, 34475205	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Sarcoma Kaposi	Sarcoma	Pubtator	24244164	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Sick Sinus Syndrome	Sick sinus syndrome	Pubtator	36171622	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Carcinoma	Stomach Carcinoma	BEFREE	26549737		★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	26549737	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	36171622, 36292671	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Thyroid Cancer Papillary	Papillary thyroid cancer	Pubtator	28855631	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Thyroid carcinoma	Thyroid Carcinoma	BEFREE	28855631		★★★★★ ★☆☆☆☆ Found in Text Mining only
Thyroid Neoplasm	Thyroid Neoplasm	BEFREE	28855631		★★★★★ ★☆☆☆☆ Found in Text Mining only
Thyroid Neoplasms	Thyroid cancer	Pubtator	28855631	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Uterine Cervical Neoplasms	Uterine neoplasm	Pubtator	29461619	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Wilms Tumor	Wilms tumor	Pubtator	32214060	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only

MAP4K4 (mitogen-activated protein kinase kinase kinase kinase 4)