TNFSF8 (TNF superfamily member 8)

Gene

• Entrez ID: 944
• Gene name: TNF superfamily member 8
• Gene symbol: TNFSF8
• Synonyms (NCBI Gene): CD153, CD30L, CD30LG, TNLG3A
• Chromosome: 9
• Chromosome location: 9q32-q33.1
• Summary: The protein encoded by this gene is a cytokine that belongs to the tumor necrosis factor (TNF) ligand family. This cytokine is a ligand for TNFRSF8/CD30, which is a cell surface antigen and a marker for Hodgkin lymphoma and related hematologic malignancie

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT650724	hsa-miR-4724-5p	HITS-CLIP	23824327
MIRT665107	hsa-miR-6510-5p	HITS-CLIP	23824327
MIRT650721	hsa-miR-2115-5p	HITS-CLIP	23824327
MIRT665106	hsa-miR-2681-5p	HITS-CLIP	23824327
MIRT650735	hsa-miR-1228-3p	HITS-CLIP	23824327
MIRT650734	hsa-miR-500b-3p	HITS-CLIP	23824327
MIRT650732	hsa-miR-6736-3p	HITS-CLIP	23824327
MIRT650733	hsa-miR-4267	HITS-CLIP	23824327
MIRT650731	hsa-miR-3127-3p	HITS-CLIP	23824327
MIRT650730	hsa-miR-6756-3p	HITS-CLIP	23824327
MIRT650729	hsa-miR-205-5p	HITS-CLIP	23824327
MIRT650728	hsa-miR-342-3p	HITS-CLIP	23824327
MIRT650727	hsa-miR-5696	HITS-CLIP	23824327
MIRT650726	hsa-miR-579-3p	HITS-CLIP	23824327
MIRT650725	hsa-miR-664b-3p	HITS-CLIP	23824327
MIRT650724	hsa-miR-4724-5p	HITS-CLIP	23824327
MIRT650723	hsa-miR-9500	HITS-CLIP	23824327
MIRT650721	hsa-miR-2115-5p	HITS-CLIP	23824327
MIRT650724	hsa-miR-4724-5p	HITS-CLIP	23824327
MIRT665107	hsa-miR-6510-5p	HITS-CLIP	23824327
MIRT650721	hsa-miR-2115-5p	HITS-CLIP	23824327
MIRT665106	hsa-miR-2681-5p	HITS-CLIP	23824327
MIRT650735	hsa-miR-1228-3p	HITS-CLIP	23824327
MIRT650734	hsa-miR-500b-3p	HITS-CLIP	23824327
MIRT650732	hsa-miR-6736-3p	HITS-CLIP	23824327
MIRT650733	hsa-miR-4267	HITS-CLIP	23824327
MIRT650731	hsa-miR-3127-3p	HITS-CLIP	23824327
MIRT650730	hsa-miR-6756-3p	HITS-CLIP	23824327
MIRT650729	hsa-miR-205-5p	HITS-CLIP	23824327
MIRT650728	hsa-miR-342-3p	HITS-CLIP	23824327
MIRT650727	hsa-miR-5696	HITS-CLIP	23824327
MIRT650726	hsa-miR-579-3p	HITS-CLIP	23824327
MIRT650725	hsa-miR-664b-3p	HITS-CLIP	23824327
MIRT650724	hsa-miR-4724-5p	HITS-CLIP	23824327
MIRT650723	hsa-miR-9500	HITS-CLIP	23824327
MIRT650721	hsa-miR-2115-5p	HITS-CLIP	23824327
MIRT1443570	hsa-miR-1228	CLIP-seq
MIRT1443571	hsa-miR-128	CLIP-seq
MIRT1443572	hsa-miR-1284	CLIP-seq
MIRT1443573	hsa-miR-140-3p	CLIP-seq
MIRT1443574	hsa-miR-30a	CLIP-seq
MIRT1443575	hsa-miR-30b	CLIP-seq
MIRT1443576	hsa-miR-30c	CLIP-seq
MIRT1443577	hsa-miR-30d	CLIP-seq
MIRT1443578	hsa-miR-30e	CLIP-seq
MIRT1443579	hsa-miR-3115	CLIP-seq
MIRT1443580	hsa-miR-629	CLIP-seq
MIRT2132742	hsa-miR-2053	CLIP-seq
MIRT2353820	hsa-miR-1243	CLIP-seq

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005102	Function	Signaling receptor binding	IEA
GO:0005102	Function	Signaling receptor binding	TAS	8391931
GO:0005125	Function	Cytokine activity	IEA
GO:0005164	Function	Tumor necrosis factor receptor binding	IEA
GO:0005515	Function	Protein binding	IPI	32296183
GO:0005615	Component	Extracellular space	IEA
GO:0005886	Component	Plasma membrane	TAS	8391931
GO:0006955	Process	Immune response	IEA
GO:0007154	Process	Cell communication	IEA
GO:0007165	Process	Signal transduction	IEA
GO:0007267	Process	Cell-cell signaling	TAS	8391931
GO:0016020	Component	Membrane	IEA
GO:0023052	Process	Signaling	IEA
GO:0042129	Process	Regulation of T cell proliferation	TAS	8391931
GO:0043374	Process	CD8-positive, alpha-beta T cell differentiation	IBA
GO:0043374	Process	CD8-positive, alpha-beta T cell differentiation	IEA
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	IEA
GO:0050830	Process	Defense response to Gram-positive bacterium	IEA

Other IDs

• MIM: 603875
• HGNC: 11938
• e!Ensembl: ENSG00000106952

Protein

• UniProt ID: P32971
• Protein name: Tumor necrosis factor ligand superfamily member 8 (CD30 ligand) (CD30-L) (CD antigen CD153)
• Protein function: Cytokine that binds to TNFRSF8/CD30. Induces proliferation of T-cells.
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00229	TNF	113 → 230	TNF(Tumour Necrosis Factor) family	Domain

• Sequence:

  MDPGLQQALNGMAPPGDTAMHVPAGSVASHLGTTSRSYFYLTTATLALCLVFTVATIMVL
  VVQRTDSIPNSPDNVPLKGGNCSEDLLCILKRAPFKKSWAYLQVAKHLNKTKLSWNKDGI
  LHGVRYQDGNLVIQFPGLYFIICQLQFLVQCPNNSVDLKLELLINKHIKKQALVTVCESG
  MQTKHVYQNLSQFLLDYLQVNTTISVNVDTFQYIDTSTFPLENVLSIFLYSNSD

• Sequence length: 234

Pathways

KEGG:

Cytokine-cytokine receptor interaction

Reactome:

TNFs bind their physiological receptors

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
CARCINOGENESIS	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CARCINOMA, EMBRYONAL	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CARDIOMYOPATHY, DILATED	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CHRONIC OBSTRUCTIVE AIRWAY DISEASE	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CROHN'S DISEASE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DIABETES MELLITUS, CONGENITAL AUTOIMMUNE	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
EOSINOPHILIA	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
GRAFT VS HOST DISEASE	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
GRAFT-VS-HOST DISEASE	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
GRAVES DISEASE	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HASHIMOTO DISEASE	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HODGKIN DISEASE	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HYPEREOSINOPHILIC SYNDROME	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
INFLAMMATORY BOWEL DISEASE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LEPROSY	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LEUKEMIA, LYMPHOCYTIC, CHRONIC, B-CELL	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LEUKEMIA, MYELOID, ACUTE	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LEUKEMIA-LYMPHOMA, ADULT T-CELL	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LYMPHOMA, B-CELL	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MULTIPLE MYELOMA	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MYOCARDITIS	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PULMONARY DISEASE, CHRONIC OBSTRUCTIVE	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TUBERCULOMA	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Acute lymphocytic leukemia	Lymphocytic Leukemia	BEFREE	7528856		★☆☆☆☆ Found in Text Mining only
Adult Hodgkin Lymphoma	Hodgkin Lymphoma	BEFREE	15508524, 30952099		★☆☆☆☆ Found in Text Mining only
Anodontia	Anodontia	Pubtator	8896393	Associate	★☆☆☆☆ Found in Text Mining only
Autoimmune Diseases	Autoimmune Diseases	BEFREE	28646041, 30952099		★☆☆☆☆ Found in Text Mining only
Bone Diseases	Bone Disease	BEFREE	19657367		★☆☆☆☆ Found in Text Mining only
Bone Diseases	Bone disease	Pubtator	19657367	Associate	★☆☆☆☆ Found in Text Mining only
Burkitt Lymphoma	Burkitt`s Lymphoma	BEFREE	7528856		★☆☆☆☆ Found in Text Mining only
Carcinoma Basal Cell	Basal cell carcinoma	Pubtator	17268792	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma of lung	Lung carcinoma	BEFREE	21292647		★☆☆☆☆ Found in Text Mining only
Chronic Lymphocytic Leukemia	Lymphocytic Leukemia	BEFREE	11175813, 16270354		★☆☆☆☆ Found in Text Mining only
Chronic Obstructive Airway Disease	Chronic Obstructive Pulmonary Disease	BEFREE	29984229		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Chronic rhinosinusitis with nasal polyps	Rhinosinusitis With Nasal Polyps	BEFREE	30570137		★☆☆☆☆ Found in Text Mining only
Colitis	Colitis	BEFREE	21068411		★☆☆☆☆ Found in Text Mining only
Crohn Disease	Crohn Disease	GWASDB_DG	16221758, 23266558		★☆☆☆☆ Found in Text Mining only
Dermatitis Atopic	Atopic dermatitis	Pubtator	16964309	Associate	★☆☆☆☆ Found in Text Mining only
Dermatitis, Atopic	Dermatitis	BEFREE	16964309		★☆☆☆☆ Found in Text Mining only
Dermatitis, Atopic	Dermatitis	LHGDN	16964309		★☆☆☆☆ Found in Text Mining only
Dermatologic disorders	Dermatologic Disorders	BEFREE	16964309		★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Insulin-Dependent	Diabetes Mellitus	BEFREE	11960307		★☆☆☆☆ Found in Text Mining only
Eczema	Eczema	BEFREE	16964309		★☆☆☆☆ Found in Text Mining only
Germ cell tumor	Tumor	BEFREE	9111512		★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	BEFREE	30952099		★☆☆☆☆ Found in Text Mining only
Hashimoto Disease	Hashimoto Disease	BEFREE	16372246		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hashimoto Disease	Hashimoto Disease	LHGDN	16372246		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hematologic Neoplasms	Hematologic neoplasm	Pubtator	9058727	Associate	★☆☆☆☆ Found in Text Mining only
Hemoglobinuria Paroxysmal	Hemoglobinuria paroxysmal	Pubtator	28630090	Associate	★☆☆☆☆ Found in Text Mining only
Hodgkin Disease	Hodgkin Disease	BEFREE	11552987, 15508524, 30952099, 7528856, 8656679		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hodgkin Disease	Hodgkin disease	Pubtator	11815953, 8701986, 8896393, 9058727	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hypereosinophilic Syndrome	Hypereosinophilic syndrome	Pubtator	8896393	Stimulate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Inflammatory Bowel Diseases	Inflammatory Bowel Disease	BEFREE	30472806		★☆☆☆☆ Found in Text Mining only
Ki-1+ Anaplastic Large Cell Lymphoma	Anaplastic Lymphoma	BEFREE	16982741, 7528856		★☆☆☆☆ Found in Text Mining only
Leprosy	Leprosy	BEFREE	25320285		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Leukemia	Leukemia	Pubtator	11175813	Associate	★☆☆☆☆ Found in Text Mining only
leukemia	Leukemia	LHGDN	18689277		★☆☆☆☆ Found in Text Mining only
Leukemia Hairy Cell	Hairy cell leukemia	Pubtator	9058727	Associate	★☆☆☆☆ Found in Text Mining only
Leukemia Myeloid Acute	Myeloid leukemia	Pubtator	9058727	Stimulate	★☆☆☆☆ Found in Text Mining only
Leukemia, Myelocytic, Acute	Leukemia	BEFREE	11728464		★☆☆☆☆ Found in Text Mining only
Liver Cirrhosis Biliary	Liver cirrhosis	Pubtator	29773854	Associate	★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung neoplasms	Pubtator	21292647	Associate	★☆☆☆☆ Found in Text Mining only
Lymphoma	Lymphoma	BEFREE	11594583, 17387297, 8833395		★☆☆☆☆ Found in Text Mining only
Lymphoma, Non-Hodgkin	Non-Hodgkin lymphoma	BEFREE	7528856		★☆☆☆☆ Found in Text Mining only
Lymphomatoid Papulosis	Lymphomatoid Papulosis	BEFREE	11594583, 17387297		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of lung	Lung Cancer	BEFREE	21292647		★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	30472806		★☆☆☆☆ Found in Text Mining only
Mastocytosis	Mastocytosis	BEFREE	24745678		★☆☆☆☆ Found in Text Mining only
Mastocytosis, Systemic	Mastocytosis	BEFREE	24745678		★☆☆☆☆ Found in Text Mining only
Melanoma Cutaneous Malignant	Melanoma	Pubtator	19626699	Associate	★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Multiple myeloma	BEFREE	19657367		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Multiple Myeloma	Multiple myeloma	Pubtator	19657367, 9058727	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Nasal Polyps	Nasal polyposis	BEFREE	30570137		★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	11594583, 16982741, 30952099		★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasms	Pancreatic neoplasm	Pubtator	35030986	Associate	★☆☆☆☆ Found in Text Mining only
Precursor Cell Lymphoblastic Leukemia Lymphoma	Lymphoblastic Leukemia	BEFREE	7528856		★☆☆☆☆ Found in Text Mining only
Primary biliary cirrhosis	Biliary Cirrhosis	GWASDB_DG	23000144		★☆☆☆☆ Found in Text Mining only
Psoriasis	Psoriasis	BEFREE	16964309, 31005389		★☆☆☆☆ Found in Text Mining only
Psoriasis	Psoriasis	LHGDN	16964309		★☆☆☆☆ Found in Text Mining only
Psoriasis	Psoriasis	Pubtator	16964309	Associate	★☆☆☆☆ Found in Text Mining only
Skin Diseases	Skin disease	Pubtator	16964309	Associate	★☆☆☆☆ Found in Text Mining only
Spondylarthritis	Spondyloarthritis	BEFREE	21480186		★☆☆☆☆ Found in Text Mining only
Thyroid Nodule	Thyroid Nodule	LHGDN	12553555		★☆☆☆☆ Found in Text Mining only
Uterine Cervical Neoplasms	Uterine neoplasm	Pubtator	31511581	Associate	★☆☆☆☆ Found in Text Mining only