TNFRSF8 (TNF receptor superfamily member 8)

Gene

• Entrez ID: 943
• Gene name: TNF receptor superfamily member 8
• Gene symbol: TNFRSF8
• Synonyms (NCBI Gene): CD30, D1S166E, Ki-1
• Chromosome: 1
• Chromosome location: 1p36.22
• Summary: The protein encoded by this gene is a member of the TNF-receptor superfamily. This receptor is expressed by activated, but not by resting, T and B cells. TRAF2 and TRAF5 can interact with this receptor, and mediate the signal transduction that leads to th

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT719567	hsa-miR-4738-5p	HITS-CLIP	19536157
MIRT719566	hsa-miR-600	HITS-CLIP	19536157
MIRT719565	hsa-miR-4297	HITS-CLIP	19536157
MIRT719564	hsa-miR-5581-5p	HITS-CLIP	19536157
MIRT719563	hsa-miR-6512-3p	HITS-CLIP	19536157
MIRT719562	hsa-miR-6720-5p	HITS-CLIP	19536157
MIRT719567	hsa-miR-4738-5p	HITS-CLIP	19536157
MIRT719566	hsa-miR-600	HITS-CLIP	19536157
MIRT719565	hsa-miR-4297	HITS-CLIP	19536157
MIRT719564	hsa-miR-5581-5p	HITS-CLIP	19536157
MIRT719563	hsa-miR-6512-3p	HITS-CLIP	19536157
MIRT719562	hsa-miR-6720-5p	HITS-CLIP	19536157
MIRT719567	hsa-miR-4738-5p	HITS-CLIP	19536157
MIRT719566	hsa-miR-600	HITS-CLIP	19536157
MIRT719565	hsa-miR-4297	HITS-CLIP	19536157
MIRT719564	hsa-miR-5581-5p	HITS-CLIP	19536157
MIRT719563	hsa-miR-6512-3p	HITS-CLIP	19536157
MIRT719562	hsa-miR-6720-5p	HITS-CLIP	19536157
MIRT719567	hsa-miR-4738-5p	HITS-CLIP	19536157
MIRT719566	hsa-miR-600	HITS-CLIP	19536157
MIRT719565	hsa-miR-4297	HITS-CLIP	19536157
MIRT719564	hsa-miR-5581-5p	HITS-CLIP	19536157
MIRT719563	hsa-miR-6512-3p	HITS-CLIP	19536157
MIRT719562	hsa-miR-6720-5p	HITS-CLIP	19536157
MIRT1443128	hsa-miR-1207-3p	CLIP-seq
MIRT1443129	hsa-miR-1307	CLIP-seq
MIRT1443130	hsa-miR-1321	CLIP-seq
MIRT1443131	hsa-miR-147	CLIP-seq
MIRT1443132	hsa-miR-1470	CLIP-seq
MIRT1443133	hsa-miR-2117	CLIP-seq
MIRT1443134	hsa-miR-2681	CLIP-seq
MIRT1443135	hsa-miR-3145-5p	CLIP-seq
MIRT1443136	hsa-miR-3162-5p	CLIP-seq
MIRT1443137	hsa-miR-3178	CLIP-seq
MIRT1443138	hsa-miR-3179	CLIP-seq
MIRT1443139	hsa-miR-3194-5p	CLIP-seq
MIRT1443140	hsa-miR-34a	CLIP-seq
MIRT1443141	hsa-miR-34c-5p	CLIP-seq
MIRT1443142	hsa-miR-3611	CLIP-seq
MIRT1443143	hsa-miR-371b-3p	CLIP-seq
MIRT1443144	hsa-miR-382	CLIP-seq
MIRT1443145	hsa-miR-3921	CLIP-seq
MIRT1443146	hsa-miR-3943	CLIP-seq
MIRT1443147	hsa-miR-4273	CLIP-seq
MIRT1443148	hsa-miR-4323	CLIP-seq
MIRT1443149	hsa-miR-4432	CLIP-seq
MIRT1443150	hsa-miR-4435	CLIP-seq
MIRT1443151	hsa-miR-4455	CLIP-seq
MIRT1443152	hsa-miR-4494	CLIP-seq
MIRT1443153	hsa-miR-449a	CLIP-seq
MIRT1443154	hsa-miR-449b	CLIP-seq
MIRT1443155	hsa-miR-4506	CLIP-seq
MIRT1443156	hsa-miR-4638-5p	CLIP-seq
MIRT1443157	hsa-miR-4649-3p	CLIP-seq
MIRT1443158	hsa-miR-4653-5p	CLIP-seq
MIRT1443159	hsa-miR-4667-3p	CLIP-seq
MIRT1443160	hsa-miR-4690-3p	CLIP-seq
MIRT1443161	hsa-miR-4707-3p	CLIP-seq
MIRT1443162	hsa-miR-4739	CLIP-seq
MIRT1443163	hsa-miR-4756-5p	CLIP-seq
MIRT1443164	hsa-miR-4793-5p	CLIP-seq
MIRT1443165	hsa-miR-597	CLIP-seq
MIRT1443166	hsa-miR-609	CLIP-seq
MIRT2132623	hsa-miR-140-3p	CLIP-seq
MIRT2132624	hsa-miR-185	CLIP-seq
MIRT2132625	hsa-miR-3150b-3p	CLIP-seq
MIRT2132626	hsa-miR-4270	CLIP-seq
MIRT2132627	hsa-miR-4306	CLIP-seq
MIRT2132628	hsa-miR-4434	CLIP-seq
MIRT2132629	hsa-miR-4436a	CLIP-seq
MIRT2132630	hsa-miR-4441	CLIP-seq
MIRT2132631	hsa-miR-4514	CLIP-seq
MIRT2132632	hsa-miR-4516	CLIP-seq
MIRT2132633	hsa-miR-4522	CLIP-seq
MIRT2132634	hsa-miR-4531	CLIP-seq
MIRT2132635	hsa-miR-4644	CLIP-seq
MIRT2132636	hsa-miR-4645-5p	CLIP-seq
MIRT1443159	hsa-miR-4667-3p	CLIP-seq
MIRT2132637	hsa-miR-4673	CLIP-seq
MIRT2132638	hsa-miR-4685-5p	CLIP-seq
MIRT2132639	hsa-miR-4692	CLIP-seq
MIRT2132640	hsa-miR-4700-3p	CLIP-seq
MIRT2132641	hsa-miR-4784	CLIP-seq
MIRT2132642	hsa-miR-508-5p	CLIP-seq
MIRT2132643	hsa-miR-516b	CLIP-seq
MIRT2132644	hsa-miR-940	CLIP-seq
MIRT2353642	hsa-miR-1207-5p	CLIP-seq
MIRT2353643	hsa-miR-3176	CLIP-seq
MIRT2353644	hsa-miR-3922-3p	CLIP-seq
MIRT2132631	hsa-miR-4514	CLIP-seq
MIRT2132636	hsa-miR-4645-5p	CLIP-seq
MIRT2132637	hsa-miR-4673	CLIP-seq
MIRT2132639	hsa-miR-4692	CLIP-seq
MIRT2353645	hsa-miR-4717-5p	CLIP-seq
MIRT2353646	hsa-miR-4757-5p	CLIP-seq
MIRT2353647	hsa-miR-4763-3p	CLIP-seq
MIRT1443164	hsa-miR-4793-5p	CLIP-seq
MIRT2132644	hsa-miR-940	CLIP-seq
MIRT2353646	hsa-miR-4757-5p	CLIP-seq

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0002020	Function	Protease binding	IPI	12777399
GO:0004888	Function	Transmembrane signaling receptor activity	IEA
GO:0004888	Function	Transmembrane signaling receptor activity	TAS	1310894
GO:0005654	Component	Nucleoplasm	IDA
GO:0005737	Component	Cytoplasm	IEA
GO:0005886	Component	Plasma membrane	IDA
GO:0005886	Component	Plasma membrane	IEA
GO:0005886	Component	Plasma membrane	TAS
GO:0007165	Process	Signal transduction	IEA
GO:0007165	Process	Signal transduction	TAS	10192335
GO:0008285	Process	Negative regulation of cell population proliferation	TAS	10192335
GO:0016020	Component	Membrane	IEA
GO:0032759	Process	Positive regulation of TRAIL production	IDA	16108830
GO:0032760	Process	Positive regulation of tumor necrosis factor production	IDA	16108830
GO:0043065	Process	Positive regulation of apoptotic process	IDA	16108830
GO:0070062	Component	Extracellular exosome	HDA	20458337
GO:0071260	Process	Cellular response to mechanical stimulus	IEP	19593445

Other IDs

• MIM: 153243
• HGNC: 11923
• e!Ensembl: ENSG00000120949

Protein

• UniProt ID: P28908
• Protein name: Tumor necrosis factor receptor superfamily member 8 (CD30L receptor) (Ki-1 antigen) (Lymphocyte activation antigen CD30) (CD antigen CD30)
• Protein function: Receptor for TNFSF8/CD30L (PubMed:8391931). May play a role in the regulation of cellular growth and transformation of activated lymphoblasts. Regulates gene expression through activation of NF-kappa-B (PubMed:8999898). {ECO:0000269|PubMed:83919
• PDB: 1D01
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00020	TNFR_c6	108 → 149	TNFR/NGFR cysteine-rich region	Domain

• Tissue specificity: TISSUE SPECIFICITY: [Isoform 2]: Detected in alveolar macrophages (at protein level). {ECO:0000269|PubMed:8839832}.
• Sequence:

  MRVLLAALGLLFLGALRAFPQDRPFEDTCHGNPSHYYDKAVRRCCYRCPMGLFPTQQCPQ
  RPTDCRKQCEPDYYLDEADRCTACVTCSRDDLVEKTPCAWNSSRVCECRPGMFCSTSAVN
  SCARCFFHSVCPAGMIVKFPGTAQKNTVCEPASPGVSPACASPENCKEPSSGTIPQAKPT
  PVSPATSSASTMPVRGGTRLAQEAASKLTRAPDSPSSVGRPSSDPGLSPTQPCPEGSGDC
  RKQCEPDYYLDEAGRCTACVSCSRDDLVEKTPCAWNSSRTCECRPGMICATSATNSCARC
  VPYPICAAETVTKPQDMAEKDTTFEAPPLGTQPDCNPTPENGEAPASTSPTQSLLVDSQA
  SKTLPIPTSAPVALSSTGKPVLDAGPVLFWVILVLVVVVGSSAFLLCHRRACRKRIRQKL
  HLCYPVQTSQPKLELVDSRPRRSSTQLRSGASVTEPVAEERGLMSQPLMETCHSVGAAYL
  ESLPLQDASPAGGPSSPRDLPEPRVSTEHTNNKIEKIYIMKADTVIVGTVKAELPEGRGL
  AGPAEPELEEELEADHTPHYPEQETEPPLGSCSDVMLSVEEEGKEDPLPTAASGK

• Sequence length: 595

Pathways

KEGG:

Cytokine-cytokine receptor interaction

Reactome:

TNFs bind their physiological receptors

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
ASTHMA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ATOPIC ASTHMA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CARCINOMA, EMBRYONAL	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CARDIOMYOPATHY, DILATED	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CHRONIC GINGIVITIS	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CHRONIC OBSTRUCTIVE AIRWAY DISEASE	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
EMPHYSEMA	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
GINGIVITIS	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
GRAFT VS HOST DISEASE	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
GRAFT-VS-HOST DISEASE	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
GRAVES DISEASE	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HASHIMOTO DISEASE	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HEMORRHAGE	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HODGKIN DISEASE	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MESOTHELIOMA, MALIGNANT	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MYOCARDITIS	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
NASOPHARYNGEAL CARCINOMA	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Prostate cancer	Uncertain significance	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PULMONARY DISEASE, CHRONIC OBSTRUCTIVE	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
RESPIRATORY SYSTEM DISEASE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Acquired Hypogammaglobulinemia	Common Variable Immunodeficiency	BEFREE	23654079		★☆☆☆☆ Found in Text Mining only
Acute Erythroblastic Leukemia	Erythroblastic Leukemia	BEFREE	9600114		★☆☆☆☆ Found in Text Mining only
Acute leukemia	Leukemia	BEFREE	11488062		★☆☆☆☆ Found in Text Mining only
Acute lymphocytic leukemia	Lymphocytic Leukemia	BEFREE	23937105		★☆☆☆☆ Found in Text Mining only
Adult Acute Lymphocytic Leukemia	Lymphocytic Leukemia	BEFREE	23937105		★☆☆☆☆ Found in Text Mining only
Adult Diffuse Large B-Cell Lymphoma	B-cell Lymphoma	BEFREE	12459631, 14726824, 23343832, 26340843, 27443517, 27592544, 27816715, 27868471, 28035754, 28521633, 29666157, 30962205, 31335688		★☆☆☆☆ Found in Text Mining only
Adult Hodgkin Lymphoma	Hodgkin Lymphoma	BEFREE	10570745, 10845927, 11004694, 11418184, 11727269, 12670918, 12875982, 12939740, 15933052, 16108827, 16108830, 16140928, 16152613, 16198418, 17261581, 18179710, 18416816, 19131627, 19377047, 19540595, 20423913, 21619423, 22107829, 22296097, 24043362, 26156801, 26621039, 26768687, 26809026, 28190142, 28359170, 28427526, 28665214, 28780614, 28805662, 29207679, 29280762, 29316337, 29390984, 29742695, 29806104, 29889102, 30140037, 30350336, 30962205, 31616638, 7528856, 8391931, 9168896		★☆☆☆☆ Found in Text Mining only
Adult Hodgkin Lymphoma	Hodgkin Lymphoma	CTD_human_DG	12453859, 16879607		★☆☆☆☆ Found in Text Mining only
Adult T-Cell Lymphoma/Leukemia	T-Cell Lymphoma/Leukemia	BEFREE	1323224, 19864230, 29166501, 30068708, 7866279		★☆☆☆☆ Found in Text Mining only
Adult T-Cell Lymphoma/Leukemia	T-Cell Lymphoma/Leukemia	LHGDN	15876358		★☆☆☆☆ Found in Text Mining only
Aggressive Systemic Mastocytosis	Systemic Mastocytosis	BEFREE	21186345, 22372203, 29794740		★☆☆☆☆ Found in Text Mining only
alpha Thalassemia	Alpha thalassemia	Pubtator	32482310	Associate	★☆☆☆☆ Found in Text Mining only
Alveolitis, Fibrosing	Alveolitis	BEFREE	15257558		★☆☆☆☆ Found in Text Mining only
Alzheimer Disease	Alzheimer disease	Pubtator	31666081	Associate	★☆☆☆☆ Found in Text Mining only
Amaurosis congenita of Leber, type 1	Leber congenital amaurosis	BEFREE	8750633		★☆☆☆☆ Found in Text Mining only
Amyloidosis Primary Cutaneous	Amyloidosis	Pubtator	10556192, 12648233, 31640798	Associate	★☆☆☆☆ Found in Text Mining only
Anaplasia	Anaplasia	BEFREE	11473453, 22738254		★☆☆☆☆ Found in Text Mining only
Anaplastic Large Cell Lymphoma, ALK-Positive	Anaplastic Lymphoma	BEFREE	31072226		★☆☆☆☆ Found in Text Mining only
Angioedemas Hereditary	Angioedema	Pubtator	15050749	Associate	★☆☆☆☆ Found in Text Mining only
Angioendotheliomatosis	Angioendotheliomatosis	BEFREE	29369392, 30779218		★☆☆☆☆ Found in Text Mining only
Angioimmunoblastic Lymphadenopathy	Angioimmunoblastic T-cell lymphoma	BEFREE	26574847, 30914464		★☆☆☆☆ Found in Text Mining only
Anodontia	Anodontia	Pubtator	8896393	Associate	★☆☆☆☆ Found in Text Mining only
Aortic Aneurysm Abdominal	Aortic aneurysm	Pubtator	23690195	Associate	★☆☆☆☆ Found in Text Mining only
Aplastic Anemia	Aplastic anemia	BEFREE	25383872		★☆☆☆☆ Found in Text Mining only
Aplastic anemia, idiopathic	Anemia	BEFREE	25383872		★☆☆☆☆ Found in Text Mining only
Arthritis Juvenile	Juvenile arthritis	Pubtator	12847694	Associate	★☆☆☆☆ Found in Text Mining only
Arthritis Rheumatoid	Rheumatoid arthritis	Pubtator	14726963, 22915618, 28850672, 31316164, 8536371	Associate	★☆☆☆☆ Found in Text Mining only
Asthma	Asthma	BEFREE	18089617, 20600327		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Asthma	Asthma	Pubtator	19610265, 29466680, 32032632, 35579040	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Ataxia Telangiectasia	Ataxia telangiectasia	Pubtator	36796016	Associate	★☆☆☆☆ Found in Text Mining only
Autoimmune Diseases	Autoimmune Diseases	BEFREE	12034885, 12538158, 16372246, 23654079, 28646041		★☆☆☆☆ Found in Text Mining only
B-Cell Lymphomas	B-Cell Lymphoma	BEFREE	10362793, 10757332, 11972717, 12402391, 12920229, 14726824, 15475930, 15692063, 2168505, 25076300, 27521276, 28885612, 29126177, 29361381, 30962205, 9684923		★☆☆☆☆ Found in Text Mining only
B-Cell Lymphomas	B-Cell Lymphoma	LHGDN	16651853		★☆☆☆☆ Found in Text Mining only
Barrett Esophagus	Barrett esophagus	BEFREE	28719438		★☆☆☆☆ Found in Text Mining only
Basal Ganglia Diseases	Basal ganglia disease	Pubtator	2492402	Associate	★☆☆☆☆ Found in Text Mining only
Behcet Syndrome	Behcet disease	Pubtator	29534057	Associate	★☆☆☆☆ Found in Text Mining only
beta Thalassemia	Beta thalassemia	Pubtator	19843386, 40121643	Associate	★☆☆☆☆ Found in Text Mining only
Bipolar Disorder	Bipolar disorder	Pubtator	35618730	Stimulate	★☆☆☆☆ Found in Text Mining only
Blood Coagulation Disorders	Blood coagulation disorder	Pubtator	18614853	Associate	★☆☆☆☆ Found in Text Mining only
Bone Marrow Diseases	Bone marrow diseases	Pubtator	11891807	Associate	★☆☆☆☆ Found in Text Mining only
Bone Marrow Diseases	Bone marrow diseases	Pubtator	25974110	Stimulate	★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	10966781, 30979742, 31393373		★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	30453988, 31393373, 31795964, 35999655, 38287674	Associate	★☆☆☆☆ Found in Text Mining only
Bronchiectasis	Bronchiectasis	BEFREE	23654079		★☆☆☆☆ Found in Text Mining only
Bronchiolitis Obliterans	Bronchiolitis Obliterans	LHGDN	18047935, 18926413		★☆☆☆☆ Found in Text Mining only
Burkitt Lymphoma	Burkitt lymphoma	Pubtator	1375849, 1845900, 27407111	Associate	★☆☆☆☆ Found in Text Mining only
Burkitt Lymphoma	Burkitt`s Lymphoma	BEFREE	1845900, 7694007, 8833395		★☆☆☆☆ Found in Text Mining only
Carcinoma	Carcinoma	Pubtator	24747435, 25589494, 9345059	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Basal Cell	Basal cell carcinoma	Pubtator	17268792	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Embryonal	Embryonal carcinoma	Pubtator	10793083, 16200333, 17277761, 20660931, 2849300, 28941150, 29222199, 32999426, 7856755, 8053487	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	33129621	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma of lung	Lung carcinoma	BEFREE	29537283		★☆☆☆☆ Found in Text Mining only
Carcinoma Renal Cell	Renal cell carcinoma	Pubtator	10052743, 34346239	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Squamous Cell	Squamous cell carcinoma	Pubtator	33394379	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma, Ovarian Epithelial	Ovarian Epithelial carcinoma	BEFREE	29933751		★☆☆☆☆ Found in Text Mining only
Celiac Disease	Celiac disease	Pubtator	12171959, 20166880	Associate	★☆☆☆☆ Found in Text Mining only
Celiac Disease	Celiac disease	BEFREE	20166880, 26531107		★☆☆☆☆ Found in Text Mining only
Chilblains	Chilblain lesions	BEFREE	28719438		★☆☆☆☆ Found in Text Mining only
Childhood Acute Lymphoblastic Leukemia	Lymphoblastic Leukemia	BEFREE	23937105		★☆☆☆☆ Found in Text Mining only
Childhood Ataxia with Central Nervous System Hypomyelinization	Leukoencephalopathy with vanishing white matter	BEFREE	28719438		★☆☆☆☆ Found in Text Mining only
Chordoma	Chordoma	Pubtator	18094369	Associate	★☆☆☆☆ Found in Text Mining only
Chronic Disease	Chronic disease	Pubtator	16964309	Associate	★☆☆☆☆ Found in Text Mining only
Chronic kidney disease stage 5	Kidney Disease	BEFREE	26970513		★☆☆☆☆ Found in Text Mining only
Chronic Obstructive Airway Disease	Chronic Obstructive Pulmonary Disease	BEFREE	29984229		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Chronic rhinosinusitis with nasal polyps	Rhinosinusitis With Nasal Polyps	BEFREE	30570137		★☆☆☆☆ Found in Text Mining only
Chronic sinusitis	Sinusitis	BEFREE	10414397		★☆☆☆☆ Found in Text Mining only
Colitis	Colitis	BEFREE	21068411		★☆☆☆☆ Found in Text Mining only
Colitis Ulcerative	Ulcerative colitis	Pubtator	37638002	Associate	★☆☆☆☆ Found in Text Mining only
Colitis Ulcerative	Ulcerative colitis	Pubtator	9528894	Stimulate	★☆☆☆☆ Found in Text Mining only
Colon Carcinoma	Colon Carcinoma	BEFREE	31331813		★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	33527196	Associate	★☆☆☆☆ Found in Text Mining only
Common Variable Immunodeficiency	Common Variable Immunodeficiency	LHGDN	17912490		★☆☆☆☆ Found in Text Mining only
Common Variable Immunodeficiency	Common Variable Immunodeficiency	BEFREE	23654079		★☆☆☆☆ Found in Text Mining only
Common Variable Immunodeficiency	Common variable immunodeficiency	Pubtator	23654079	Associate	★☆☆☆☆ Found in Text Mining only
Congenital chromosomal disease	Congenital Chromosomal Disease	BEFREE	10629553, 14595754, 18237230, 2157342, 30068708, 8876615, 9613994		★☆☆☆☆ Found in Text Mining only
Congestive heart failure	Congestive Heart Failure	BEFREE	29487310		★☆☆☆☆ Found in Text Mining only
Coronary Artery Disease	Coronary artery disease	Pubtator	24098343	Associate	★☆☆☆☆ Found in Text Mining only
Critical Illness	Critical illness	Pubtator	33041191	Associate	★☆☆☆☆ Found in Text Mining only
Cutaneous Fibrous Histiocytoma	Fibrous Histiocytoma	BEFREE	24666231		★☆☆☆☆ Found in Text Mining only
Cutaneous Mastocytosis	Cutaneous mastocytosis	BEFREE	29794740		★☆☆☆☆ Found in Text Mining only
Dentatorubral-Pallidoluysian Atrophy	Dentatorubral Pallidoluysian Atrophy	BEFREE	11049994		★☆☆☆☆ Found in Text Mining only
Dermatitis	Dermatitis	BEFREE	31005389		★☆☆☆☆ Found in Text Mining only
Dermatitis Atopic	Atopic dermatitis	Pubtator	9328133	Associate	★☆☆☆☆ Found in Text Mining only
Dermatitis Atopic 1	Atopic dermatitis	Pubtator	8870700	Associate	★☆☆☆☆ Found in Text Mining only
Dermatologic disorders	Dermatologic Disorders	BEFREE	12826883		★☆☆☆☆ Found in Text Mining only
Dermoid Cyst	Dermoid Cyst	BEFREE	28521633		★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes mellitus	Pubtator	11046041, 22385239	Associate	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Insulin-Dependent	Diabetes Mellitus	BEFREE	11960307		★☆☆☆☆ Found in Text Mining only
Diabetes, Autoimmune	Autoimmune Diabetes	BEFREE	11960307		★☆☆☆☆ Found in Text Mining only
Diffuse Large B-Cell Lymphoma	Diffuse Lymphoma	BEFREE	10757332, 12459631, 14726824, 19430986, 19806362, 2153959, 23343832, 25760242, 25813203, 26258272, 26340843, 27443517, 27592544, 27816715, 27868471, 28035754, 28521633, 29126177, 29666157, 30841880, 30962205, 31335688, 31752540, 8639911		★☆☆☆☆ Found in Text Mining only
Eczema	Eczema	GWASCAT_DG	30595370		★☆☆☆☆ Found in Text Mining only
Embryonal Neoplasm	Embryonal Neoplasm	BEFREE	16115909		★☆☆☆☆ Found in Text Mining only
Endometrial Neoplasms	Endometrial neoplasm	Pubtator	36199963	Associate	★☆☆☆☆ Found in Text Mining only
Endometriosis	Endometriosis	Pubtator	22259059	Associate	★☆☆☆☆ Found in Text Mining only
Enteropathy-Associated T-Cell Lymphoma	Enteropathy-Associated T-Cell Lymphoma	BEFREE	21323966		★☆☆☆☆ Found in Text Mining only
Eosinophilia	Eosinophilia	Pubtator	10666192	Associate	★☆☆☆☆ Found in Text Mining only
Esophageal Neoplasms	Esophageal neoplasm	Pubtator	39465737	Associate	★☆☆☆☆ Found in Text Mining only
Frontotemporal Dementia	Frontotemporal dementia	Pubtator	36890594	Stimulate	★☆☆☆☆ Found in Text Mining only
GATA2 Deficiency	Gata2 deficiency	Pubtator	23690195, 25429803, 28486951, 36740715	Associate	★☆☆☆☆ Found in Text Mining only
Gaucher Disease	Gaucher disease	Pubtator	1334945	Associate	★☆☆☆☆ Found in Text Mining only
Germ cell tumor	Tumor	BEFREE	20090517, 21619423, 28427526, 28941150, 29222199, 9111512		★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	Pubtator	32687679	Associate	★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	Pubtator	37810780	Associate	★☆☆☆☆ Found in Text Mining only
Graft vs Host Disease	Graft-versus-host disease	Pubtator	22661699, 39465737	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Graves Disease	Graves Disease	BEFREE	16372246		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hamman-Rich syndrome	Hamman-Rich syndrome	BEFREE	15257558		★☆☆☆☆ Found in Text Mining only
Hashimoto Disease	Hashimoto Disease	BEFREE	16372246		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hashimoto Disease	Hashimoto Disease	LHGDN	16372246		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Head and Neck Neoplasms	Head and neck neoplasm	Pubtator	26617911	Associate	★☆☆☆☆ Found in Text Mining only
Heart failure	Heart Failure	BEFREE	29487310		★☆☆☆☆ Found in Text Mining only
Hemangiosarcoma	Hemangiosarcoma	BEFREE	28475514		★☆☆☆☆ Found in Text Mining only
Hematologic Neoplasms	Hematologic Neoplasms	BEFREE	12097283, 21619423, 26809026, 27592544, 27893466, 28513851, 31161871		★☆☆☆☆ Found in Text Mining only
Hepatitis B Chronic	Hepatitis b	Pubtator	37995395	Associate	★☆☆☆☆ Found in Text Mining only
Hereditary Breast and Ovarian Cancer Syndrome	Hereditary breast and ovarian cancer syndrome	Pubtator	28715445, 31454283	Stimulate	★☆☆☆☆ Found in Text Mining only
Hereditary Breast and Ovarian Cancer Syndrome	Hereditary breast and ovarian cancer syndrome	Pubtator	34791787, 35999655	Associate	★☆☆☆☆ Found in Text Mining only
High Grade Lymphoma (neoplasm)	High Grade Lymphoma	BEFREE	24551312		★☆☆☆☆ Found in Text Mining only
Histiocytoma Angiomatoid Fibrous	Angiomatoid fibrous histiocytoma	Pubtator	26261484	Associate	★☆☆☆☆ Found in Text Mining only
Histiocytoma, Angiomatoid Fibrous	Histiocytoma	BEFREE	24666231		★☆☆☆☆ Found in Text Mining only
Hodgkin Disease	Hodgkin Disease	BEFREE	10080826, 10570745, 10599944, 10629553, 10830738, 10845927, 11004694, 11110706, 11266530, 11372737, 11418184, 11727269, 11971184, 12097283, 12213729, 12456498, 12459631, 12670918, 12875982, 12939740, 1310894, 1320954, 1323222, 1337292, 15105813, 15356338, 15933052, 16049514, 16108827, 16108830, 16140928, 16152613, 16198418, 16533741, 16917214, 17261581, 17973241, 18179710, 18416816, 19131627, 19377047, 19540595, 20423913, 21619423, 22107829, 22296097, 23968853, 24043362, 26156801, 26621039, 26768687, 26809026, 28153507, 28190142, 28359170, 28427526, 28521633, 28556361, 28665214, 28708333, 28780614, 28805662, 28993768, 29207679, 29280762, 29316337, 29390984, 29742695, 29806104, 29889102, 29999431, 30093402, 30140037, 30350336, 3040565, 30841880, 30962205, 31161871, 31476851, 31616638, 7507733, 7520272, 7522624, 7528856, 7742546, 8035614, 8187071, 8217820, 8218985, 8383422, 8391931, 8522287, 8605360, 8617454, 8630409, 8639911, 8656679, 8724538, 8781433, 8833395, 8946602, 9168896, 9638979, 9707610, 9894470		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hodgkin Disease	Hodgkin disease	Pubtator	10494126, 10666192, 11049994, 11675352, 11756152, 11815953, 12218070, 12456498, 12689928, 12875982, 1333303, 15093542, 15105813, 16108830, 16200333, 16244703, 16964309, 17106517, 17510532, 17965727, 18179710, 18187570, 18416816, 19131627, 19465900, 20063524, 21385932, 21859738, 22107829, 22367293, 23343832, 23968853, 23988031, 24633193, 24670809, 2492402, 25044944, 25589494, 26105086, 26768687, 27870927, 2849300, 28695742, 28802087, 28805662, 2898211, 2963547, 29889102, 29950526, 29950528, 30140037, 3158209, 32102582, 3307442, 35472771, 37079526, 37302818, 37377225, 37559724, 3876124, 7527617, 7632954, 8630409, 8639911, 8701985, 8704179, 8781433, 8896393, 9327746, 9707610, 9886332	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hodgkin Disease	Hodgkin Disease	LHGDN	12389614, 12875982, 15026356, 16108827, 17106517		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hodgkin Disease	Hodgkin Disease	CTD_human_DG	12453859, 16879607		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hodgkin Disease	Hodgkin disease	Pubtator	1323222, 20591198	Stimulate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hodgkin Disease	Hodgkin disease	Pubtator	31787352	Inhibit	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hodgkin lymphoma, lymphocyte depletion	Hodgkin Lymphoma, Lymphocyte Depletion	CTD_human_DG	12453859, 16879607		★☆☆☆☆ Found in Text Mining only
Hyperinsulinism	Hyperinsulinism	Pubtator	18582564	Stimulate	★☆☆☆☆ Found in Text Mining only
Hyperplasia	Hyperplasia	Pubtator	10432289	Associate	★☆☆☆☆ Found in Text Mining only
Idiopathic Pulmonary Fibrosis	Pulmonary Fibrosis	BEFREE	15257558		★☆☆☆☆ Found in Text Mining only
Immunologic Deficiency Syndromes	Immunologic Deficiency Syndromes	BEFREE	30671911		★☆☆☆☆ Found in Text Mining only
Indolent Systemic Mastocytosis	Indolent Systemic Mastocytosis	BEFREE	22372203, 24111625		★☆☆☆☆ Found in Text Mining only
Inflammatory Bowel Diseases	Inflammatory Bowel Disease	BEFREE	29541900		★☆☆☆☆ Found in Text Mining only
Inflammatory Bowel Diseases	Inflammatory bowel disease	Pubtator	9528894	Associate	★☆☆☆☆ Found in Text Mining only
Inflammatory dermatosis	Dermatitis	BEFREE	31005389		★☆☆☆☆ Found in Text Mining only
Inflammatory Myofibroblastic Tumor	Inflammatory Myofibroblastic Tumor	BEFREE	24666231		★☆☆☆☆ Found in Text Mining only
Intestinal Diseases	Intestinal Diseases	BEFREE	11260307		★☆☆☆☆ Found in Text Mining only
Kaposi Sarcoma	Kaposi Sarcoma	BEFREE	10421407		★☆☆☆☆ Found in Text Mining only
Ki-1+ Anaplastic Large Cell Lymphoma	Anaplastic Lymphoma	BEFREE	10080826, 10235516, 10400186, 10514417, 10555007, 10658913, 10702393, 10757332, 10830738, 10955685, 11090048, 11106821, 11110706, 11138613, 11266530, 11313991, 11358725, 11426532, 11473453, 11493472, 11607814, 12097283, 12213729, 12456498, 12696066, 12826883, 1313990, 1323222, 1337292, 15050749, 15093542, 15104308, 15105813, 15165197, 15202521, 15291361, 15297316, 15475930, 15713979, 15902287, 15933052, 16049514, 16108830, 16140928, 16198418, 16351635, 16412208, 16533741, 1668608, 16982741, 17076712, 17261581, 17308066, 17320171, 17387297, 17519389, 17720243, 17973241, 18179710, 18237230, 19074096, 19091487, 19131627, 19131793, 19358142, 19657361, 19864230, 19890350, 2004329, 20118908, 21169992, 21366363, 2156548, 21619423, 21741362, 22107829, 22613996, 22687603, 22773605, 23028875, 23149700, 23716562, 23838350, 23923083, 23968853, 24043362, 24404580, 24666231, 24696735, 24766435, 25128227, 25145835, 25353265, 25820993, 25840583, 25869285, 26531107, 26576861, 26621039, 26809026, 27521276, 27592544, 27870927, 27927047, 28035754, 28153507, 28209473, 28247950, 28427526, 28485010, 28497585, 28521633, 28626950, 28652442, 28805086, 28805662, 28993768, 2917127, 29242300, 29316337, 29390984, 29516333, 29597249, 29601554, 29617304, 29806104, 29898383, 30093402, 30292067, 30522922, 30526166, 30659762, 30742941, 30909793, 30914464, 30953147, 31002934, 31045236, 31101622, 31274669, 31466587, 31476851, 31495882, 31581676, 31667195, 31695174, 31705818, 31706671, 31754210, 7507733, 7528856, 7564510, 7655022, 7662979, 7697626, 7742546, 7780128, 7856744, 8035614, 8103295, 8169113, 8204884, 8221575, 8394168, 8522287, 8605362, 8611713, 8666370, 8772789, 8781434, 8800065, 8916968, 9021682, 9028963, 9057627, 9209644, 9243361, 9274957, 9449486, 9484639, 9561912, 9598798, 9613994, 9638979, 9684923, 9808552, 9886332, 9894470		★☆☆☆☆ Found in Text Mining only
Ki-1+ Anaplastic Large Cell Lymphoma	Anaplastic Lymphoma	LHGDN	11891807, 12389614, 15050749, 17973241		★☆☆☆☆ Found in Text Mining only
Kidney Failure, Chronic	Kidney Failure	BEFREE	26970513		★☆☆☆☆ Found in Text Mining only
Kidney Neoplasms	Kidney neoplasm	Pubtator	36046723	Associate	★☆☆☆☆ Found in Text Mining only
Leukemia	Leukemia	Pubtator	10595933, 11175813, 28978570	Associate	★☆☆☆☆ Found in Text Mining only
leukemia	Leukemia	BEFREE	11175813		★☆☆☆☆ Found in Text Mining only
leukemia	Leukemia	LHGDN	18689277		★☆☆☆☆ Found in Text Mining only
Leukemia	Leukemia	Pubtator	3876124	Stimulate	★☆☆☆☆ Found in Text Mining only
Leukemia Myeloid	Myeloid leukemia	Pubtator	11313272, 27893466	Associate	★☆☆☆☆ Found in Text Mining only
Leukemia Myeloid Acute	Myeloid leukemia	Pubtator	10595933, 23313069, 27893466, 7685204	Associate	★☆☆☆☆ Found in Text Mining only
Leukemia, Mast-Cell	Leukemia	BEFREE	22372203, 24111625, 29794740		★☆☆☆☆ Found in Text Mining only
Leukemia, Myelocytic, Acute	Leukemia	BEFREE	27893466		★☆☆☆☆ Found in Text Mining only
Leukemia, T-Cell	T-cell leukemia	BEFREE	7866279		★☆☆☆☆ Found in Text Mining only
Leukocyte adhesion deficiency type 1	Leukocyte adhesion deficiency	BEFREE	31648255		★☆☆☆☆ Found in Text Mining only
Liver Cirrhosis	Liver Cirrhosis	LHGDN	18165785		★☆☆☆☆ Found in Text Mining only
Liver Diseases	Liver disease	Pubtator	26783377	Associate	★☆☆☆☆ Found in Text Mining only
Lung diseases	Lung Diseases	BEFREE	29537283		★☆☆☆☆ Found in Text Mining only
Lung Diseases Interstitial	Lung disease	Pubtator	10845432	Associate	★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus Systemic	Systemic lupus erythematosus	Pubtator	10793083, 21437440	Associate	★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus Systemic	Systemic lupus erythematosus	Pubtator	23790231	Stimulate	★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus, Cutaneous	Lupus Erythematosus	BEFREE	28719438		★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus, Systemic	Lupus Erythematosus	BEFREE	16306881, 27389558		★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus, Systemic	Lupus Erythematosus	LHGDN	17103120		★☆☆☆☆ Found in Text Mining only
Lymphadenitis	Lymphadenitis	BEFREE	31648255		★☆☆☆☆ Found in Text Mining only
Lymphocyte Rich Classical Hodgkin Lymphoma	Classical Hodgkin lymphoma	CTD_human_DG	12453859, 16879607		★☆☆☆☆ Found in Text Mining only
Lymphoma	Lymphoma	Pubtator	10556192, 10595933, 10803703, 10955685, 11046041, 11121138, 11729213, 11756152, 12171959, 12393570, 1312308, 15105813, 15920551, 17643097, 23716548, 23968853, 24747435, 24805132, 25046457, 2546633, 2556926, 2789474, 2898211, 29758590, 3020097, 30764603, 31026116, 31393373, 32803917, 33367520, 35428467, 35472771, 35948003, 37079526, 37290910, 37377225, 37975251, 38149948, 7507733, 7745117, 7856744, 8013619, 8053487, 8132806, 8639911, 8701987, 9331891, 9616164, 9711895	Associate	★☆☆☆☆ Found in Text Mining only
Lymphoma	Lymphoma	BEFREE	10658913, 10767704, 10830738, 10845927, 10955685, 11029515, 11048978, 11120787, 11121148, 11357228, 11423937, 11594583, 12091351, 12202671, 12459631, 12538158, 12648233, 1323222, 1323224, 15105813, 15257558, 15356338, 15894695, 1668608, 17339188, 17387297, 17635241, 18230757, 18237230, 19131793, 20055841, 21366363, 2156548, 21741362, 2174301, 2198552, 22979947, 23028547, 23338758, 23968853, 24043362, 24233555, 24878027, 25961700, 26576861, 27521276, 27927047, 27993440, 28247950, 28427526, 28486951, 28638848, 28829215, 29052238, 29316337, 29597249, 29758590, 29889102, 30362019, 30375407, 30520526, 30572149, 30734344, 30841880, 30993587, 31335688, 31383966, 31393373, 31567279, 31581676, 31834627, 31838747, 3260525, 7507733, 7655001, 7780128, 7856744, 8187071, 8383422, 8539233, 8541553, 8604686, 8617454, 8639911, 8666370, 8701987, 8778335, 8806956, 8833395, 9168896, 9261474, 9274957, 9484639, 9517514, 9616164, 9684923, 9885224		★☆☆☆☆ Found in Text Mining only
Lymphoma	Lymphoma	LHGDN	15356338, 16108830		★☆☆☆☆ Found in Text Mining only
Lymphoma Follicular	Lymphoma	Pubtator	10666192	Associate	★☆☆☆☆ Found in Text Mining only
Lymphoma Primary Cutaneous Anaplastic Large Cell	Primary cutaneous anaplastic large cell lymphoma	Pubtator	11121138, 15105813, 18633437, 19890350, 20118908, 22565437, 23368872, 25405321, 2556926, 26458652, 29510190, 31640798, 32147503, 34382383, 36990776, 37544586, 9331891, 9347791	Associate	★☆☆☆☆ Found in Text Mining only
Lymphoma Primary Cutaneous Anaplastic Large Cell	Primary cutaneous anaplastic large cell lymphoma	Pubtator	33234878	Stimulate	★☆☆☆☆ Found in Text Mining only
Lymphoma, Extranodal NK-T-Cell	Lymphoma	BEFREE	29052238, 29166501, 29662666		★☆☆☆☆ Found in Text Mining only
Lymphoma, Follicular	Lymphoma	BEFREE	11473453, 15475930, 9158676		★☆☆☆☆ Found in Text Mining only
Lymphoma, Non-Hodgkin	Non-Hodgkin lymphoma	BEFREE	10767704, 1323222, 1326891, 16982741, 2157342, 22687603, 24696735, 25869285, 30909793, 31476851, 3260522, 7528856, 7564510, 7655022, 8204884, 8562929, 8616796, 9021682, 9684923, 9858312		★☆☆☆☆ Found in Text Mining only
Lymphoma, Non-Hodgkin, Familial	Lymphoma	BEFREE	10767704, 1323222, 1326891, 16982741, 2157342, 22687603, 24696735, 25869285, 30909793, 3260522, 7564510, 7655022, 8616796, 9858312		★☆☆☆☆ Found in Text Mining only
Lymphoma, T-Cell, Cutaneous	Lymphoma	BEFREE	10433941, 11453809, 11531801, 12648233, 1323224, 14595754, 15897551, 16412208, 18782321, 19812605, 20118908, 21209378, 2175544, 22884443, 23149700, 24747435, 25548993, 26266670, 27345620, 28119332, 28337783, 28600132, 28805086, 28980004, 29107664, 29248547, 29719017, 30294921, 30526166, 30572149, 30630983, 30841880, 31141854, 31303340, 31355940, 9162223, 9274957, 9347791, 9536217, 9616164		★☆☆☆☆ Found in Text Mining only
Lymphoma, Undifferentiated	Lymphoma	BEFREE	30907476, 8701987		★☆☆☆☆ Found in Text Mining only
Lymphomatoid Papulosis	Lymphomatoid Papulosis	BEFREE	10025972, 10433941, 11168749, 11531801, 11553311, 11594583, 12091351, 12150138, 12826883, 15105813, 15894695, 16412208, 16965435, 17076712, 17387297, 1850775, 18782321, 19335692, 20661014, 20669794, 21169992, 22472952, 22688398, 23026936, 23149700, 23713913, 25131361, 25349176, 25353265, 27993440, 28937425, 28980004, 29067932, 29146059, 29171395, 29361381, 29660166, 29806104, 29851705, 30325389, 30430444, 30520526, 30957244, 31045236, 31188140, 31466587, 31494989, 31577659, 31705818, 7615976, 8605362, 8701987, 8781433, 8806956, 8941669, 9347791, 9415224, 9536217, 9638979, 9894470		★☆☆☆☆ Found in Text Mining only
Lymphomatoid Papulosis	Lymphomatoid Papulosis	LHGDN	12091351		★☆☆☆☆ Found in Text Mining only
Lymphoproliferative Disorders	Lymphoproliferative syndrome	Pubtator	10556192, 10595933, 10793083, 10955685, 15133473, 18633437, 19220628, 19922478, 20511667, 21169992, 22388754, 22588448, 23026936, 23375504, 24128129, 24747435, 25046457, 25349176, 26111483, 26261247, 26504818, 26617911, 27345620, 27893466, 29893430, 31355940, 32102582, 32147503, 32771472, 33234878, 8605362, 8781433, 9347791, 9449486	Associate	★☆☆☆☆ Found in Text Mining only
Lymphoproliferative Disorders	Lymphoproliferative Disorder	BEFREE	10955685, 11972717, 14750239, 15133473, 15692063, 15894695, 16412208, 17083688, 17387297, 19091487, 19846813, 20661014, 21169992, 22565437, 22773605, 23026936, 23149700, 24747435, 24805854, 24878027, 25131361, 25349176, 25353265, 26266670, 27345620, 27521276, 27592544, 27893466, 27993440, 28035754, 28342276, 28400633, 28400635, 28497585, 28614957, 28654766, 28860025, 28965629, 28980004, 28993768, 29107664, 29126177, 29166501, 29318585, 29369392, 29473196, 29719017, 30074622, 30292067, 30294921, 30325389, 30430444, 30630983, 30670369, 30946099, 31045236, 31179774, 31355940, 31466587, 31494989, 31577659, 31640798, 31705818, 31706333, 31781845, 8605362, 8781433, 8941669, 9347791, 9415224, 9449486, 9638979		★☆☆☆☆ Found in Text Mining only
Lymphoproliferative Disorders	Lymphoproliferative syndrome	Pubtator	31640798	Stimulate	★☆☆☆☆ Found in Text Mining only
Macular Degeneration	Macular degeneration	Pubtator	28231837	Associate	★☆☆☆☆ Found in Text Mining only
Malignant mesothelioma	Malignant Mesothelioma	CTD_human_DG	23056237		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	10966781, 30979742, 31393373		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of lung	Lung Cancer	BEFREE	29537283		★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	10376974, 10506709, 10845927, 11004694, 11266530, 11751393, 11756152, 1313990, 16049514, 17261581, 19846813, 20423913, 21619423, 21844453, 23654079, 24233555, 27342211, 27345620, 27592544, 28427526, 28521633, 28805662, 29222199, 30068708, 30788039, 30979742, 30993587, 31218098, 31393373, 31705818, 8103295, 8522287		★☆☆☆☆ Found in Text Mining only
Malignant tumor of colon	Colonic Neoplasms	BEFREE	31331813		★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	LHGDN	18320364		★☆☆☆☆ Found in Text Mining only
Mastocytosis	Mastocytosis	BEFREE	21186345, 24745678, 29794740, 31120154		★☆☆☆☆ Found in Text Mining only
Mastocytosis	Mastocytosis	Pubtator	21186345, 29794740, 35596520	Associate	★☆☆☆☆ Found in Text Mining only
Mastocytosis Cutaneous	Mastocytosis	Pubtator	29794740	Associate	★☆☆☆☆ Found in Text Mining only
Mastocytosis Systemic	Systemic mastocytosis	Pubtator	21186345, 29794740, 30696068, 31350306, 36982353	Associate	★☆☆☆☆ Found in Text Mining only
Mastocytosis, Systemic	Mastocytosis	BEFREE	20616612, 21112036, 21186345, 22372203, 24111625, 24745678, 29794740, 31350306		★☆☆☆☆ Found in Text Mining only
Mediastinal (Thymic) Large B-Cell Lymphoma	B-Cell Lymphoma	BEFREE	27521276		★☆☆☆☆ Found in Text Mining only
Medullary carcinoma	Megalencephaly, Polymicrogyria, Polydactyly, Hydrocephalus Syndrome	BEFREE	24551312		★☆☆☆☆ Found in Text Mining only
Medullary carcinoma of thyroid	Megalencephaly, Polymicrogyria, Polydactyly, Hydrocephalus Syndrome	BEFREE	24551312		★☆☆☆☆ Found in Text Mining only
melanoma	Melanoma	BEFREE	24395820		★☆☆☆☆ Found in Text Mining only
Melanoma	Melanoma	Pubtator	35909944	Associate	★☆☆☆☆ Found in Text Mining only
Mesothelioma	Mesothelioma	Pubtator	15644135, 16200333, 25589494, 30993587	Associate	★☆☆☆☆ Found in Text Mining only
Mesothelioma	Mesothelioma	BEFREE	28427526, 30993587		★☆☆☆☆ Found in Text Mining only
Mesothelioma Malignant	Mesothelioma	Pubtator	25589494	Associate	★☆☆☆☆ Found in Text Mining only
Mixed Cellularity Hodgkin Lymphoma	Classical Hodgkin lymphoma	CTD_human_DG	12453859, 16879607		★☆☆☆☆ Found in Text Mining only
Mucosa-Associated Lymphoid Tissue Lymphoma	Mucosa-associated lymphoma	BEFREE	12459631		★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Multiple myeloma	Pubtator	10595933	Associate	★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Multiple myeloma	BEFREE	30913860		★☆☆☆☆ Found in Text Mining only
Mycosis Fungoides	Mycosis fungoides	Pubtator	19898220, 26195720, 26261247, 3158209, 32771472, 33794441, 36428999, 37544586, 37790936	Associate	★☆☆☆☆ Found in Text Mining only
Myelodysplastic Syndromes	Myelodysplastic syndrome	Pubtator	23313069	Associate	★☆☆☆☆ Found in Text Mining only
Myeloid Leukemia	Myeloid Leukemia	BEFREE	16776717, 27893466		★☆☆☆☆ Found in Text Mining only
Nasal Polyps	Nasal polyposis	BEFREE	30570137		★☆☆☆☆ Found in Text Mining only
Nasal Type Extranodal NK/T-Cell Lymphoma	Extranodal NK T Cell Lymphoma	BEFREE	10803703, 16776717, 21867533, 23119111, 28486951, 29052238		★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	10514417, 10845927, 11048978, 11049994, 11110706, 11121148, 11178628, 11781220, 12213729, 12648233, 12670918, 14595754, 15104308, 15105813, 16108827, 16533741, 16838279, 16982741, 17507664, 19131627, 19377047, 20090517, 21186345, 21425149, 2156548, 22107829, 22296097, 23119111, 23302373, 23716562, 25349176, 26097614, 26574847, 27521276, 27685149, 27816715, 28341790, 28427526, 28441375, 28551388, 28800008, 28885612, 29222199, 29276022, 29390984, 29560124, 29758590, 29893342, 30788039, 31286556, 31331813, 3260525, 8380117, 8541553, 8617454, 9136160, 9684923		★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	BEFREE	28521633		★☆☆☆☆ Found in Text Mining only
Nodular Lymphocyte Predominant Hodgkin Lymphoma	Classical Hodgkin lymphoma	CTD_human_DG	12453859, 16879607		★☆☆☆☆ Found in Text Mining only
Nodular Lymphocyte Predominant Hodgkin Lymphoma	Classical Hodgkin lymphoma	BEFREE	24525501, 25704629		★☆☆☆☆ Found in Text Mining only
Nodular Sclerosis Classical Hodgkin Lymphoma	Classical Hodgkin lymphoma	BEFREE	10362793, 8724538		★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	Pubtator	18078524	Associate	★☆☆☆☆ Found in Text Mining only
Oropharyngeal Neoplasms	Oropharyngeal neoplasm	Pubtator	34655411	Associate	★☆☆☆☆ Found in Text Mining only
Osteoarthritis	Osteoarthritis	Pubtator	31251756, 38132170, 9077531	Associate	★☆☆☆☆ Found in Text Mining only
Ovarian Diseases	Ovarian diseases	Pubtator	22759382	Associate	★☆☆☆☆ Found in Text Mining only
Pancytopenia	Pancytopenia	BEFREE	25383872		★☆☆☆☆ Found in Text Mining only
Parkinson Disease	Parkinson disease	Pubtator	34132705, 34955458	Associate	★☆☆☆☆ Found in Text Mining only
Pemphigus	Pemphigus	Pubtator	32926429	Associate	★☆☆☆☆ Found in Text Mining only
Perforation of colon	Perforation Of Colon	BEFREE	31610336		★☆☆☆☆ Found in Text Mining only
Peripheral Nervous System Diseases	Peripheral nervous system disease	Pubtator	26261247	Associate	★☆☆☆☆ Found in Text Mining only
Peripheral Nervous System Diseases	Nervous System Diseases	BEFREE	28805086		★☆☆☆☆ Found in Text Mining only
Peripheral Neuropathy	Peripheral Neuropathy	BEFREE	28805086		★☆☆☆☆ Found in Text Mining only
Peripheral T-Cell Lymphoma	T-Cell Lymphoma	BEFREE	10830738, 15297316, 19358142, 22773605, 23716562, 24481943, 25224410, 25833963, 26574847, 27626696, 27655118, 28485010, 29507077, 29719411, 29898383, 30522922, 30526166, 30868027, 30914464, 31119775, 31695174, 31808829, 31834627, 31838747		★☆☆☆☆ Found in Text Mining only
Polycystic Ovary Syndrome	Polycystic Ovary Syndrome	BEFREE	19567527		★☆☆☆☆ Found in Text Mining only
Precursor Cell Lymphoblastic Leukemia Lymphoma	Lymphoblastic Leukemia	BEFREE	10029445, 23937105		★☆☆☆☆ Found in Text Mining only
Primary Cutaneous Anaplastic Large Cell Lymphoma	Anaplastic Lymphoma	BEFREE	12648233, 12696066, 14595754, 15475930, 17511113, 20669794, 22773605, 24666231, 24696735, 25349176, 25353265, 26266670, 26458652, 27993440, 28342276, 28497585, 28570392, 28600132, 29103006, 29473196, 30430444, 30943788, 31141854, 31466587, 31577659, 31705818		★☆☆☆☆ Found in Text Mining only
Psoriasis	Psoriasis	Pubtator	16964309	Associate	★☆☆☆☆ Found in Text Mining only
Psoriasis	Psoriasis	BEFREE	31005389		★☆☆☆☆ Found in Text Mining only
Psychotic Disorders	Psychotic disorders	Pubtator	35618730	Associate	★☆☆☆☆ Found in Text Mining only
Pulmonary Disease Chronic Obstructive	Chronic obstructive pulmonary disease	Pubtator	36655999	Associate	★☆☆☆☆ Found in Text Mining only
Reticulosarcoma	Reticulosarcoma	BEFREE	10080826, 10767704, 11048978, 11121148, 1979248, 22565437, 29195114, 7615976, 8162060, 8227539, 8396607, 8605362, 8781433, 8941669, 9033279, 9158676, 9182822, 9216718, 9638979		★☆☆☆☆ Found in Text Mining only
Retinoblastoma	Retinoblastoma	BEFREE	12966346		★☆☆☆☆ Found in Text Mining only
Rheumatoid Arthritis	Rheumatoid arthritis	BEFREE	10754341		★☆☆☆☆ Found in Text Mining only
Rheumatoid Arthritis	Rheumatoid arthritis	LHGDN	14726963		★☆☆☆☆ Found in Text Mining only
Sarcoidosis	Sarcoidosis	BEFREE	30909793		★☆☆☆☆ Found in Text Mining only
Sarcoidosis Pulmonary	Sarcoidosis	Pubtator	26696750	Associate	★☆☆☆☆ Found in Text Mining only
Schizophrenia	Schizophrenia	Pubtator	35618730	Stimulate	★☆☆☆☆ Found in Text Mining only
Scleroderma Systemic	Systemic sclerosis	Pubtator	32538493	Associate	★☆☆☆☆ Found in Text Mining only
Sclerosis	Sclerosis	Pubtator	26261484	Associate	★☆☆☆☆ Found in Text Mining only
Seminoma	Seminoma	Pubtator	15644135, 16200333, 20660931	Associate	★☆☆☆☆ Found in Text Mining only
Seminoma	Seminoma	BEFREE	16115909, 18162782, 20881837		★☆☆☆☆ Found in Text Mining only
Sepsis	Sepsis	Pubtator	36119022	Associate	★☆☆☆☆ Found in Text Mining only
Sertoli Cell Tumor	Sertoli Cell Tumor	BEFREE	29222199		★☆☆☆☆ Found in Text Mining only
Sex Cord-Stromal Tumor	Sex Cord-Stromal Tumor	BEFREE	29222199		★☆☆☆☆ Found in Text Mining only
Sezary Syndrome	Sezary Syndrome	BEFREE	21209378, 25548993, 28648940, 28829215, 29107664, 29166501, 29806104, 30294921, 9536217		★☆☆☆☆ Found in Text Mining only
Sezary Syndrome	Sezary syndrome	Pubtator	26195720, 26261247	Associate	★☆☆☆☆ Found in Text Mining only
Sinusitis	Sinusitis	Pubtator	10414397	Associate	★☆☆☆☆ Found in Text Mining only
Sjogren's Syndrome	Sjogren syndrome	Pubtator	35705251	Associate	★☆☆☆☆ Found in Text Mining only
Skin Diseases	Skin disease	Pubtator	10556192, 21437440, 22367293, 22472952, 2556926, 8075027	Associate	★☆☆☆☆ Found in Text Mining only
Skin lesion	Skin Lesion	BEFREE	23713913, 24805861, 29794740		★☆☆☆☆ Found in Text Mining only
Skin Neoplasms	Skin Neoplasms	BEFREE	28342276		★☆☆☆☆ Found in Text Mining only
Spondylitis Ankylosing	Ankylosing spondylitis	Pubtator	26273636	Associate	★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma	Carcinoma	BEFREE	30734344		★☆☆☆☆ Found in Text Mining only
Squamous Cell Carcinoma of Head and Neck	Squamous cell carcinoma	Pubtator	25475780, 28665450, 36404537	Associate	★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	32058995, 32462010, 36253873, 37258567	Associate	★☆☆☆☆ Found in Text Mining only
Subcutaneous panniculitis-like T-cell lymphoma	Subcutaneous Panniculitis-Like T-Cell Lymphoma	BEFREE	10433941, 21763080, 31355940		★☆☆☆☆ Found in Text Mining only
Synovitis	Synovitis	BEFREE	10754341		★☆☆☆☆ Found in Text Mining only
Synovitis	Synovitis	Pubtator	8536371	Associate	★☆☆☆☆ Found in Text Mining only
Systemic Scleroderma	Scleroderma	BEFREE	9403725		★☆☆☆☆ Found in Text Mining only
T-Cell Lymphoma	T-Cell Lymphoma	BEFREE	10433941, 10949545, 10955685, 11168749, 11260307, 11298116, 11448921, 11453809, 11781220, 12150138, 12692428, 14595754, 14750239, 15897551, 1659246, 16776717, 16982741, 19846813, 19903218, 2166767, 22367293, 22613996, 22688398, 23923083, 24492285, 24604141, 24894770, 25183396, 25548993, 25942672, 28225962, 28400642, 28454236, 28626950, 28857075, 28965629, 29171395, 29248547, 29397528, 29689246, 30520526, 30526166, 30572149, 30597548, 30715169, 31316085, 31355940, 31495882, 31580408, 31667195, 31706671, 31754210, 8394652, 8539233, 8541553, 9162223, 9261474, 9327740, 9347791		★☆☆☆☆ Found in Text Mining only
T-Cell Prolymphocytic Leukemia	T-Cell Prolymphocytic Leukemia	BEFREE	26109102		★☆☆☆☆ Found in Text Mining only
Testicular Germ Cell Tumor	Testicular Germ Cell Tumor	BEFREE	31218098		★☆☆☆☆ Found in Text Mining only
Testicular Neoplasms	Testicular neoplasm	Pubtator	29222199, 30993587, 7856755	Associate	★☆☆☆☆ Found in Text Mining only
Thalassemia	Thalassemia	Pubtator	15054814	Associate	★☆☆☆☆ Found in Text Mining only
Thalassemia Intermedia	Thalassemia	BEFREE	30221402		★☆☆☆☆ Found in Text Mining only
Thyroid Nodule	Thyroid Nodule	LHGDN	12553555		★☆☆☆☆ Found in Text Mining only
Urinary Bladder Neoplasms	Urinary bladder neoplasms	Pubtator	33048468	Associate	★☆☆☆☆ Found in Text Mining only
Uterine Cervical Neoplasms	Uterine neoplasm	Pubtator	28858203, 35942212	Associate	★☆☆☆☆ Found in Text Mining only
Vascular Diseases	Vascular disease	Pubtator	16200333	Associate	★☆☆☆☆ Found in Text Mining only
Vasculitis Leukocytoclastic Cutaneous	Vasculitis	Pubtator	22388754, 24747435	Associate	★☆☆☆☆ Found in Text Mining only
Vesicular Stomatitis	Vesicular Stomatitis	BEFREE	29560124		★☆☆☆☆ Found in Text Mining only
Waldenstrom Macroglobulinemia	Waldenstrom`s Macroglobulinemia	BEFREE	16776717		★☆☆☆☆ Found in Text Mining only
X-linked agammaglobulinemia	Agammaglobulinemia, X-Linked	BEFREE	11433390		★☆☆☆☆ Found in Text Mining only