PPP1R14A (protein phosphatase 1 regulatory inhibitor subunit 14A)

Gene

• Entrez ID: 94274
• Gene name: Protein phosphatase 1 regulatory inhibitor subunit 14A
• Gene symbol: PPP1R14A
• Synonyms (NCBI Gene): CPI-17, CPI17, PPP1INL
• Chromosome: 19
• Chromosome location: 19q13.2
• Summary: The protein encoded by this gene belongs to the protein phosphatase 1 (PP1) inhibitor family. This protein is an inhibitor of smooth muscle myosin phosphatase, and has higher inhibitory activity when phosphorylated. Inhibition of myosin phosphatase leads

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT044653	hsa-miR-320a	CLASH	23622248
MIRT485984	hsa-miR-6784-5p	PAR-CLIP	23592263
MIRT485983	hsa-miR-1207-5p	PAR-CLIP	23592263
MIRT485982	hsa-miR-4763-3p	PAR-CLIP	23592263
MIRT485981	hsa-miR-4467	PAR-CLIP	23592263
MIRT485979	hsa-miR-6721-5p	PAR-CLIP	23592263
MIRT485980	hsa-miR-486-3p	PAR-CLIP	23592263
MIRT485978	hsa-miR-328-5p	PAR-CLIP	23592263
MIRT485977	hsa-miR-6885-5p	PAR-CLIP	23592263
MIRT485976	hsa-miR-1228-5p	PAR-CLIP	23592263
MIRT485984	hsa-miR-6784-5p	PAR-CLIP	23592263
MIRT485983	hsa-miR-1207-5p	PAR-CLIP	23592263
MIRT485982	hsa-miR-4763-3p	PAR-CLIP	23592263
MIRT485981	hsa-miR-4467	PAR-CLIP	23592263
MIRT485979	hsa-miR-6721-5p	PAR-CLIP	23592263
MIRT485980	hsa-miR-486-3p	PAR-CLIP	23592263
MIRT485978	hsa-miR-328-5p	PAR-CLIP	23592263
MIRT485977	hsa-miR-6885-5p	PAR-CLIP	23592263
MIRT485976	hsa-miR-1228-5p	PAR-CLIP	23592263
MIRT2302035	hsa-miR-130a	CLIP-seq
MIRT2302036	hsa-miR-130b	CLIP-seq
MIRT2302037	hsa-miR-301a	CLIP-seq
MIRT2302038	hsa-miR-301b	CLIP-seq
MIRT2302039	hsa-miR-3666	CLIP-seq
MIRT2302040	hsa-miR-4270	CLIP-seq
MIRT2302041	hsa-miR-4295	CLIP-seq
MIRT2302042	hsa-miR-4441	CLIP-seq
MIRT2302043	hsa-miR-454	CLIP-seq
MIRT2302044	hsa-miR-4693-3p	CLIP-seq
MIRT2302045	hsa-miR-4696	CLIP-seq

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0004864	Function	Protein phosphatase inhibitor activity	IEA
GO:0004865	Function	Protein serine/threonine phosphatase inhibitor activity	IBA
GO:0005737	Component	Cytoplasm	IEA
GO:0005829	Component	Cytosol	TAS
GO:0071466	Process	Cellular response to xenobiotic stimulus	IEA

Other IDs

• MIM: 608153
• HGNC: 14871
• e!Ensembl: ENSG00000167641

Protein

• UniProt ID: Q96A00
• Protein name: Protein phosphatase 1 regulatory subunit 14A (17 kDa PKC-potentiated inhibitory protein of PP1) (Protein kinase C-potentiated inhibitor protein of 17 kDa) (CPI-17)
• Protein function: Inhibitor of PPP1CA. Has over 1000-fold higher inhibitory activity when phosphorylated, creating a molecular switch for regulating the phosphorylation status of PPP1CA substrates and smooth muscle contraction.
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF05361	PP1_inhibitor	1 → 136	PKC-activated protein phosphatase-1 inhibitor	Family

• Tissue specificity: TISSUE SPECIFICITY: Isoform 1 is detected in aorta and testis. Isoform 2 is detected in aorta. {ECO:0000269|PubMed:11467857}.
• Sequence:

  MAAQRLGKRVLSKLQSPSRARGPGGSPGGLQKRHARVTVKYDRRELQRRLDVEKWIDGRL
  EELYRGMEADMPDEINIDELLELESEEERSRKIQGLLKSCGKPVEDFIQELLAKLQGLHR
  QPGLRQPSPSHDGSLSPLQDRARTAHP

• Sequence length: 147

Pathways

KEGG:

Vascular smooth muscle contraction

Reactome:

RHO GTPases activate PKNs

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
COLORECTAL NEOPLASMS	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DIVERTICULAR DISEASE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MESOTHELIOMA	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PROSTATE CANCER	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PROSTATE CARCINOMA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Acoustic Neuroma	Acoustic Neuroma	BEFREE	31789805		★☆☆☆☆ Found in Text Mining only
Benign Prostatic Hyperplasia	Benign Prostatic Hyperplasia	BEFREE	16052505, 23275439		★☆☆☆☆ Found in Text Mining only
Bladder neck obstruction	Bladder neck obstruction	BEFREE	23275439		★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	CTD_human_DG	17892325		★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	28928808		★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal Neoplasms	CTD_human_DG	17892325		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	40001597	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Diabetes Mellitus	Diabetes mellitus	Pubtator	29955616	Associate	★☆☆☆☆ Found in Text Mining only
Esophageal Neoplasms	Esophageal neoplasm	Pubtator	19472401	Associate	★☆☆☆☆ Found in Text Mining only
Esophageal Squamous Cell Carcinoma	Esophageal squamous cell carcinoma	Pubtator	19472401	Associate	★☆☆☆☆ Found in Text Mining only
Hereditary Breast and Ovarian Cancer Syndrome	Hereditary breast and ovarian cancer syndrome	Pubtator	28115406	Associate	★☆☆☆☆ Found in Text Mining only
Hypertensive disease	Hypertension	BEFREE	30948334		★☆☆☆☆ Found in Text Mining only
Lymphoma	Lymphoma	BEFREE	24260260		★☆☆☆☆ Found in Text Mining only
Lymphoma	Lymphoma	Pubtator	24260260	Associate	★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of pancreas	Pancreatic cancer	BEFREE	23541585		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	BEFREE	31308362		★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	23541585		★☆☆☆☆ Found in Text Mining only
melanoma	Melanoma	BEFREE	27793041		★☆☆☆☆ Found in Text Mining only
Mesothelioma	Mesothelioma	CTD_human_DG	18835652		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Necrotizing enterocolitis in fetus OR newborn	Necrotizing Enterocolitis	BEFREE	28962146		★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	27793041, 31789805		★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	BEFREE	30948334		★☆☆☆☆ Found in Text Mining only
Ovarian Diseases	Ovarian diseases	Pubtator	28115406	Associate	★☆☆☆☆ Found in Text Mining only
Pancreatic carcinoma	Pancreatic carcinoma	BEFREE	23541585		★☆☆☆☆ Found in Text Mining only
Prostate carcinoma	Prostate cancer	BEFREE	31308362		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Prostatic Diseases	Prostatic disease	Pubtator	34849858	Associate	★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	28115406, 34849858	Associate	★☆☆☆☆ Found in Text Mining only
Septicemia	Septicemia	BEFREE	30936247		★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	31959204, 32410620	Associate	★☆☆☆☆ Found in Text Mining only