Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Associated diseases
Entrez ID	94234
Gene name	Forkhead box Q1
Gene symbol	FOXQ1
Synonyms (NCBI Gene)	HFH1
Chromosome	6
Chromosome location	6p25.3
Summary	FOXQ1 is a member of the FOX gene family, which is characterized by a conserved 110-amino acid DNA-binding motif called the forkhead or winged helix domain. FOX genes are involved in embryonic development, cell cycle regulation, tissue-specific gene expre

161

Show/Hide all (161)

miRTarBase ID	miRNA	Experiments	Reference
MIRT018393	hsa-miR-335-5p	Microarray	18185580
MIRT030583	hsa-miR-24-3p	Microarray	19748357
MIRT485590	hsa-miR-106a-5p	PAR-CLIP	23592263
MIRT485589	hsa-miR-17-5p	PAR-CLIP	23592263
MIRT485588	hsa-miR-20a-5p	PAR-CLIP	23592263
MIRT485587	hsa-miR-20b-5p	PAR-CLIP	23592263
MIRT485586	hsa-miR-519d-3p	PAR-CLIP	23592263
MIRT485585	hsa-miR-526b-3p	PAR-CLIP	23592263
MIRT485584	hsa-miR-93-5p	PAR-CLIP	23592263
MIRT485583	hsa-miR-106b-5p	PAR-CLIP	23592263
MIRT485582	hsa-miR-6507-3p	PAR-CLIP	23592263
MIRT485581	hsa-miR-519a-3p	PAR-CLIP	23592263
MIRT485580	hsa-miR-519b-3p	PAR-CLIP	23592263
MIRT485579	hsa-miR-519c-3p	PAR-CLIP	23592263
MIRT485578	hsa-miR-130a-3p	PAR-CLIP	23592263
MIRT485577	hsa-miR-130b-3p	PAR-CLIP	23592263
MIRT485576	hsa-miR-301a-3p	PAR-CLIP	23592263
MIRT485575	hsa-miR-301b-3p	PAR-CLIP	23592263
MIRT485574	hsa-miR-3666	PAR-CLIP	23592263
MIRT485573	hsa-miR-4295	PAR-CLIP	23592263
MIRT485572	hsa-miR-454-3p	PAR-CLIP	23592263
MIRT485570	hsa-miR-3973	PAR-CLIP	23592263
MIRT485571	hsa-miR-520g-3p	PAR-CLIP	23592263
MIRT485569	hsa-miR-520h	PAR-CLIP	23592263
MIRT485568	hsa-miR-518c-5p	PAR-CLIP	23592263
MIRT485567	hsa-miR-378j	PAR-CLIP	23592263
MIRT485566	hsa-miR-6839-5p	PAR-CLIP	23592263
MIRT485565	hsa-miR-4320	PAR-CLIP	23592263
MIRT485564	hsa-miR-19a-3p	PAR-CLIP	23592263
MIRT485563	hsa-miR-19b-3p	PAR-CLIP	23592263
MIRT485562	hsa-miR-937-3p	PAR-CLIP	23592263
MIRT485561	hsa-miR-7111-3p	PAR-CLIP	23592263
MIRT485560	hsa-miR-6780a-3p	PAR-CLIP	23592263
MIRT485559	hsa-miR-6881-3p	PAR-CLIP	23592263
MIRT485558	hsa-miR-4782-5p	PAR-CLIP	23592263
MIRT485557	hsa-miR-5706	PAR-CLIP	23592263
MIRT485556	hsa-miR-518a-5p	PAR-CLIP	23592263
MIRT485555	hsa-miR-527	PAR-CLIP	23592263
MIRT737398	hsa-miR-422a	Luciferase reporter assayNorthern blot	25251503
MIRT731745	hsa-miR-1271-5p	Luciferase reporter assayqRT-PCRWestern blot	26159618
MIRT731745	hsa-miR-1271-5p	Luciferase reporter assayqRT-PCRWestern blot	26159618
MIRT408575	hsa-miR-506-3p	Luciferase reporter assayqRT-PCRWestern blot	26935526
MIRT408575	hsa-miR-506-3p	Luciferase reporter assayqRT-PCRWestern blot	26935526
MIRT408575	hsa-miR-506-3p	Luciferase reporter assayqRT-PCRWestern blot	25856555
MIRT408575	hsa-miR-506-3p	Luciferase reporter assayqRT-PCRWestern blot	25856555
MIRT485590	hsa-miR-106a-5p	PAR-CLIP	27292025
MIRT485583	hsa-miR-106b-5p	PAR-CLIP	27292025
MIRT485578	hsa-miR-130a-3p	PAR-CLIP	27292025
MIRT485577	hsa-miR-130b-3p	PAR-CLIP	27292025
MIRT485589	hsa-miR-17-5p	PAR-CLIP	27292025
MIRT485564	hsa-miR-19a-3p	PAR-CLIP	27292025
MIRT485563	hsa-miR-19b-3p	PAR-CLIP	27292025
MIRT485588	hsa-miR-20a-5p	PAR-CLIP	27292025
MIRT485587	hsa-miR-20b-5p	PAR-CLIP	27292025
MIRT485576	hsa-miR-301a-3p	PAR-CLIP	27292025
MIRT485575	hsa-miR-301b-3p	PAR-CLIP	27292025
MIRT485574	hsa-miR-3666	PAR-CLIP	27292025
MIRT485567	hsa-miR-378j	PAR-CLIP	27292025
MIRT485570	hsa-miR-3973	PAR-CLIP	27292025
MIRT485573	hsa-miR-4295	PAR-CLIP	27292025
MIRT485565	hsa-miR-4320	PAR-CLIP	27292025
MIRT485572	hsa-miR-454-3p	PAR-CLIP	27292025
MIRT485558	hsa-miR-4782-5p	PAR-CLIP	27292025
MIRT485556	hsa-miR-518a-5p	PAR-CLIP	27292025
MIRT485568	hsa-miR-518c-5p	PAR-CLIP	27292025
MIRT485581	hsa-miR-519a-3p	PAR-CLIP	27292025
MIRT485580	hsa-miR-519b-3p	PAR-CLIP	27292025
MIRT485579	hsa-miR-519c-3p	PAR-CLIP	27292025
MIRT485586	hsa-miR-519d-3p	PAR-CLIP	27292025
MIRT485571	hsa-miR-520g-3p	PAR-CLIP	27292025
MIRT485569	hsa-miR-520h	PAR-CLIP	27292025
MIRT485585	hsa-miR-526b-3p	PAR-CLIP	27292025
MIRT485555	hsa-miR-527	PAR-CLIP	27292025
MIRT485557	hsa-miR-5706	PAR-CLIP	27292025
MIRT485582	hsa-miR-6507-3p	PAR-CLIP	27292025
MIRT485560	hsa-miR-6780a-3p	PAR-CLIP	27292025
MIRT485566	hsa-miR-6839-5p	PAR-CLIP	27292025
MIRT485559	hsa-miR-6881-3p	PAR-CLIP	27292025
MIRT485561	hsa-miR-7111-3p	PAR-CLIP	27292025
MIRT485584	hsa-miR-93-5p	PAR-CLIP	27292025
MIRT485562	hsa-miR-937-3p	PAR-CLIP	27292025
MIRT485590	hsa-miR-106a-5p	Luciferase reporter assayWestern blottingqRT-PCR	31897182
MIRT737029	hsa-miR-106a-3p	Luciferase reporter assayWestern blottingqRT-PCR	31897182
MIRT485562	hsa-miR-937-3p	Luciferase reporter assayWestern blottingqRT-PCR	31417280
MIRT737398	hsa-miR-422a	Luciferase reporter assayWestern blottingImmunoprecipitaion (IP)Immunohistochemistry (IHC)RNA-seqqRT-PCRIn situ hybridization	32061262
MIRT485590	hsa-miR-106a-5p	PAR-CLIP	23592263
MIRT485589	hsa-miR-17-5p	PAR-CLIP	23592263
MIRT485588	hsa-miR-20a-5p	PAR-CLIP	23592263
MIRT485587	hsa-miR-20b-5p	PAR-CLIP	23592263
MIRT485586	hsa-miR-519d-3p	PAR-CLIP	23592263
MIRT485585	hsa-miR-526b-3p	PAR-CLIP	23592263
MIRT485584	hsa-miR-93-5p	PAR-CLIP	23592263
MIRT485583	hsa-miR-106b-5p	PAR-CLIP	23592263
MIRT485582	hsa-miR-6507-3p	PAR-CLIP	23592263
MIRT485581	hsa-miR-519a-3p	PAR-CLIP	23592263
MIRT485580	hsa-miR-519b-3p	PAR-CLIP	23592263
MIRT485579	hsa-miR-519c-3p	PAR-CLIP	23592263
MIRT485578	hsa-miR-130a-3p	PAR-CLIP	23592263
MIRT485577	hsa-miR-130b-3p	PAR-CLIP	23592263
MIRT485576	hsa-miR-301a-3p	PAR-CLIP	23592263
MIRT485575	hsa-miR-301b-3p	PAR-CLIP	23592263
MIRT485574	hsa-miR-3666	PAR-CLIP	23592263
MIRT485573	hsa-miR-4295	PAR-CLIP	23592263
MIRT485572	hsa-miR-454-3p	PAR-CLIP	23592263
MIRT485570	hsa-miR-3973	PAR-CLIP	23592263
MIRT485571	hsa-miR-520g-3p	PAR-CLIP	23592263
MIRT485569	hsa-miR-520h	PAR-CLIP	23592263
MIRT485568	hsa-miR-518c-5p	PAR-CLIP	23592263
MIRT485567	hsa-miR-378j	PAR-CLIP	23592263
MIRT485566	hsa-miR-6839-5p	PAR-CLIP	23592263
MIRT485565	hsa-miR-4320	PAR-CLIP	23592263
MIRT485564	hsa-miR-19a-3p	PAR-CLIP	23592263
MIRT485563	hsa-miR-19b-3p	PAR-CLIP	23592263
MIRT485562	hsa-miR-937-3p	PAR-CLIP	23592263
MIRT485561	hsa-miR-7111-3p	PAR-CLIP	23592263
MIRT485560	hsa-miR-6780a-3p	PAR-CLIP	23592263
MIRT485559	hsa-miR-6881-3p	PAR-CLIP	23592263
MIRT485558	hsa-miR-4782-5p	PAR-CLIP	23592263
MIRT485557	hsa-miR-5706	PAR-CLIP	23592263
MIRT485556	hsa-miR-518a-5p	PAR-CLIP	23592263
MIRT485555	hsa-miR-527	PAR-CLIP	23592263
MIRT756454	hsa-miR-378a-3p	Luciferase reporter assayWestern blottingqRT-PCR	36457036
MIRT1003663	hsa-miR-106a	CLIP-seq
MIRT1003664	hsa-miR-106b	CLIP-seq
MIRT1003665	hsa-miR-130a	CLIP-seq
MIRT1003666	hsa-miR-130b	CLIP-seq
MIRT1003667	hsa-miR-17	CLIP-seq
MIRT1003668	hsa-miR-199a-3p	CLIP-seq
MIRT1003669	hsa-miR-199b-3p	CLIP-seq
MIRT1003670	hsa-miR-19a	CLIP-seq
MIRT1003671	hsa-miR-19b	CLIP-seq
MIRT1003672	hsa-miR-20a	CLIP-seq
MIRT1003673	hsa-miR-20b	CLIP-seq
MIRT1003674	hsa-miR-301a	CLIP-seq
MIRT1003675	hsa-miR-301b	CLIP-seq
MIRT1003676	hsa-miR-3064-3p	CLIP-seq
MIRT1003677	hsa-miR-3129-5p	CLIP-seq
MIRT1003678	hsa-miR-3190	CLIP-seq
MIRT1003679	hsa-miR-342-3p	CLIP-seq
MIRT1003680	hsa-miR-3660	CLIP-seq
MIRT1003681	hsa-miR-3911	CLIP-seq
MIRT1003682	hsa-miR-3978	CLIP-seq
MIRT1003683	hsa-miR-4264	CLIP-seq
MIRT1003684	hsa-miR-4488	CLIP-seq
MIRT1003685	hsa-miR-451b	CLIP-seq
MIRT1003686	hsa-miR-4526	CLIP-seq
MIRT1003687	hsa-miR-454	CLIP-seq
MIRT1003688	hsa-miR-4697-5p	CLIP-seq
MIRT1003689	hsa-miR-4704-3p	CLIP-seq
MIRT1003690	hsa-miR-4729	CLIP-seq
MIRT1003691	hsa-miR-519a	CLIP-seq
MIRT1003692	hsa-miR-519d	CLIP-seq
MIRT1003693	hsa-miR-520g	CLIP-seq
MIRT1003694	hsa-miR-593	CLIP-seq
MIRT1003695	hsa-miR-602	CLIP-seq
MIRT1003696	hsa-miR-619	CLIP-seq
MIRT1003697	hsa-miR-648	CLIP-seq
MIRT1003698	hsa-miR-875-3p	CLIP-seq
MIRT1003699	hsa-miR-93	CLIP-seq
MIRT1997510	hsa-miR-296-5p	CLIP-seq
MIRT1997511	hsa-miR-4532	CLIP-seq

Show/Hide all (17)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000122	Process	Negative regulation of transcription by RNA polymerase II	IEA
GO:0000785	Component	Chromatin	ISA
GO:0000978	Function	RNA polymerase II cis-regulatory region sequence-specific DNA binding	IBA
GO:0000978	Function	RNA polymerase II cis-regulatory region sequence-specific DNA binding	IEA
GO:0000981	Function	DNA-binding transcription factor activity, RNA polymerase II-specific	IBA
GO:0000981	Function	DNA-binding transcription factor activity, RNA polymerase II-specific	ISA
GO:0001227	Function	DNA-binding transcription repressor activity, RNA polymerase II-specific	IEA
GO:0003677	Function	DNA binding	IEA
GO:0003700	Function	DNA-binding transcription factor activity	IEA
GO:0005634	Component	Nucleus	IEA
GO:0006355	Process	Regulation of DNA-templated transcription	IEA
GO:0006357	Process	Regulation of transcription by RNA polymerase II	IBA
GO:0009653	Process	Anatomical structure morphogenesis	IBA
GO:0030154	Process	Cell differentiation	IBA
GO:0031069	Process	Hair follicle morphogenesis	IEA
GO:0043565	Function	Sequence-specific DNA binding	IEA
GO:1990837	Function	Sequence-specific double-stranded DNA binding	IDA	28473536

MIM	HGNC	e!Ensembl
612788	20951	ENSG00000164379

Q9C009

Protein name

Forkhead box protein Q1 (HNF-3/forkhead-like protein 1) (HFH-1) (Hepatocyte nuclear factor 3 forkhead homolog 1)

Protein function

Plays a role in hair follicle differentiation.

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00250	Forkhead	118 → 205	Forkhead domain	Domain

Tissue specificity

TISSUE SPECIFICITY: Expressed predominantly in the stomach, trachea, bladder and salivary gland. {ECO:0000269|PubMed:11747606}.

Sequence

MKLEVFVPRAAHGDKQGSDLEGAGGSDAPSPLSAAGDDSLGSDGDCAANSPAAGGGARDT
QGDGEQSAGGGPGAEEAIPAAAAAAVVAEGAEAGAAGPGAGGAGSGEGARSKPYTRRPKP
PYSYIALIAMAIRDSAGGRLTLAEINEYLMGKFPFFRGSYTGWRNSVRHNLSLNDCFVKV
LRDPSRPWGKDNYWMLNPNSEYTFADGVFRRRRKRLSHRAPVPAPGLRPEEAPGLPAAPP
PAPAAPASPRMRSPARQEERASPAGKFSSSFAIDSILRKPFRSRRLRDTAPGTTLQWGAA
PCPPLPAFPALLPAAPCRALLPLCAYGAGEPARLGAREAEVPPTAPPLLLAPLPAAAPAK
PLRGPAAGGAHLYCPLRLPAALQAASVRRPGPHLPYPVETLLA

Sequence length

403

Interactions

View interactions

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (8)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
BIPOLAR DISORDER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BREAST CANCER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BREAST CARCINOMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BREAST NEOPLASMS	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
COLORECTAL MUCINOUS ADENOCARCINOMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CUTANEOUS MELANOMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MAJOR DEPRESSIVE DISORDER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SCOLIOSIS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (76)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Adenocarcinoma	Adenocarcinoma	BEFREE	22761930		★★★★★ ★☆☆☆☆ Found in Text Mining only
Autoimmune Diseases	Autoimmune Diseases	BEFREE	27176124		★★★★★ ★☆☆☆☆ Found in Text Mining only
Bladder Neoplasm	Bladder Neoplasm	BEFREE	23403865		★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	21285253, 21346143, 27129776, 31417280		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Breast Carcinoma	Breast Carcinoma	CTD_human_DG	27129776		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Breast Neoplasms	Breast neoplasm	Pubtator	23555880, 32754922	Stimulate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Breast Neoplasms	Breast neoplasm	Pubtator	27786176, 34939230, 35512572, 36319643, 36778115, 37265428, 38062011	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Carcinogenesis	Carcinogenesis	Pubtator	25955104, 33174020, 34939230, 35114976	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma	Carcinoma	BEFREE	28930679		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	31853229	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma of bladder	Bladder carcinoma	BEFREE	23403865		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma of lung	Lung carcinoma	BEFREE	26858166		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Ovarian Epithelial	Epithelial ovarian carcinoma	Pubtator	23203039	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma, Ovarian Epithelial	Ovarian Epithelial carcinoma	BEFREE	23203039, 27176124, 31517731		★★★★★ ★☆☆☆☆ Found in Text Mining only
cervical cancer	Cervical Cancer	BEFREE	26935526, 27363024		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cervix carcinoma	Cervix carcinoma	BEFREE	26935526, 27363024		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	20145154, 23555880, 23723077, 25955104, 27119506, 27162244, 28559972		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	23555880, 25955104	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	31137244, 35114976, 35633908, 36124643	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Dermatitis, Atopic	Dermatitis	BEFREE	29203829		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes mellitus	Pubtator	36978091	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetic Nephropathies	Diabetic neuropathy	Pubtator	36978091	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Eczema	Eczema	BEFREE	29203829		★★★★★ ★☆☆☆☆ Found in Text Mining only
Esophageal carcinoma	Esophageal Carcinoma	BEFREE	26349968, 28726780		★★★★★ ★☆☆☆☆ Found in Text Mining only
Esophageal Neoplasms	Esophagus Neoplasm	BEFREE	26349968, 28726780		★★★★★ ★☆☆☆☆ Found in Text Mining only
Esophageal Neoplasms	Esophageal neoplasm	Pubtator	28726780	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Ewings sarcoma	Ewing sarcoma	BEFREE	29945296		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	BEFREE	23383267, 27176124		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glycosuria Renal	Renal glycosuria	Pubtator	36978091	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypersensitivity Immediate	Hypersensitivity	Pubtator	34939230	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypersensitivity Immediate	Hypersensitivity	Pubtator	37265428	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	23623360, 24005989, 24211718, 25251503, 28367060, 29248714		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic metastasis	Pubtator	23609035, 31713908	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic metastasis	Pubtator	25955104	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	21285253, 21346143, 27129776, 31417280		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	CTD_human_DG	27129776		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of esophagus	Esophagus Neoplasm	BEFREE	26349968, 28726780		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of lung	Lung Cancer	BEFREE	26858166		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of ovary	Ovarian cancer	BEFREE	27176124, 31517731		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of pancreas	Pancreatic cancer	BEFREE	26122655		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	BEFREE	27573292		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of stomach	Stomach Neoplasms	BEFREE	23609035, 26159618, 27109028, 28791370, 29048674		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of urinary bladder	Urinary bladder cancer	BEFREE	23403865		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	21346143, 23203039, 24211718, 25287361, 25955104, 27129776, 28559972, 29534099, 30807702		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant tumor of cervix	Cervical Tumor	BEFREE	26935526, 27363024		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mammary Carcinoma, Human	Marfan Syndrome	CTD_human_DG	27129776		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	CTD_human_DG	27129776		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms, Human	Mammary Neoplasms	CTD_human_DG	27129776		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mastocytosis	Mastocytosis	Pubtator	37762215	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Mastocytosis Systemic	Systemic mastocytosis	Pubtator	37762215	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
melanoma	Melanoma	BEFREE	28930679, 29463842		★★★★★ ★☆☆☆☆ Found in Text Mining only
Nasopharyngeal carcinoma	Nasopharyngeal Carcinoma	BEFREE	25098939, 25856555, 30678643		★★★★★ ★☆☆☆☆ Found in Text Mining only
Nasopharyngeal Carcinoma	Nasopharyngeal carcinoma	Pubtator	25856555, 33875643	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	20145154, 23555880, 23609035, 23623360, 24005989, 24719318, 25856555, 26122655, 26159618, 26349968, 27129776, 27162244, 27176124, 28559972, 28726780 View all (6 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Nodular Goiter	Nodular Goiter	BEFREE	30378716		★★★★★ ★☆☆☆☆ Found in Text Mining only
Non-Small Cell Lung Carcinoma	Lung carcinoma	BEFREE	22761930, 23203039, 25356753, 31713908		★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteogenesis Imperfecta	Osteogenesis imperfecta	Pubtator	37021796	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteoporosis	Osteoporosis	Pubtator	36050744	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Ovarian Carcinoma	Ovarian Carcinoma	BEFREE	31517731		★★★★★ ★☆☆☆☆ Found in Text Mining only
ovarian neoplasm	Ovarian neoplasm	BEFREE	27176124		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Ovarian neoplasm	Pubtator	23203039, 24200849, 32977853	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatic carcinoma	Pancreatic carcinoma	BEFREE	26122655		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasms	Pancreatic neoplasm	Pubtator	37875474	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Papillary thyroid carcinoma	Papillary thyroid carcinoma	BEFREE	30378716		★★★★★ ★☆☆☆☆ Found in Text Mining only
Partial Trisomy	Trisomy	BEFREE	22407547		★★★★★ ★☆☆☆☆ Found in Text Mining only
Persistent Hyperplastic Primary Vitreous	Persistent Hyperplastic Primary Vitreous	BEFREE	22407547		★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostate carcinoma	Prostate cancer	BEFREE	27573292		★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma	Carcinoma	BEFREE	22761930		★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of esophagus	Esophagus Neoplasm	BEFREE	26349968		★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Carcinoma	Stomach Carcinoma	BEFREE	23609035, 26159618, 27109028, 28791370, 29048674		★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	23609035, 26159618, 28791370	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
T-Cell Lymphoma	T-Cell Lymphoma	BEFREE	29132010		★★★★★ ★☆☆☆☆ Found in Text Mining only
Transitional cell carcinoma of bladder	Bladder carcinoma	BEFREE	23403865, 29736319		★★★★★ ★☆☆☆☆ Found in Text Mining only
Triple Negative Breast Neoplasms	Triple negative breast cancer	Pubtator	36319643, 38062011	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Urinary Bladder Neoplasms	Urinary bladder neoplasms	Pubtator	35396504	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Uterine Cervical Neoplasms	Uterine neoplasm	Pubtator	27363024	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only

FOXQ1 (forkhead box Q1)