NTN1 (netrin 1)

Gene

• Entrez ID: 9423
• Gene name: Netrin 1
• Gene symbol: NTN1
• Synonyms (NCBI Gene): MRMV4, NET1, NTN1L
• Chromosome: 17
• Chromosome location: 17p13.1
• Summary: Netrin is included in a family of laminin-related secreted proteins. The function of this gene has not yet been defined; however, netrin is thought to be involved in axon guidance and cell migration during development. Mutations and loss of expression o

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT019443	hsa-miR-148b-3p	Microarray	17612493
MIRT042477	hsa-miR-423-3p	CLASH	23622248
MIRT036113	hsa-miR-1296-5p	CLASH	23622248
MIRT715335	hsa-miR-6769a-3p	HITS-CLIP	19536157
MIRT715334	hsa-miR-361-3p	HITS-CLIP	19536157
MIRT715333	hsa-miR-6887-3p	HITS-CLIP	19536157
MIRT715332	hsa-miR-1913	HITS-CLIP	19536157
MIRT715331	hsa-miR-324-3p	HITS-CLIP	19536157
MIRT715330	hsa-miR-4313	HITS-CLIP	19536157
MIRT715329	hsa-miR-4749-3p	HITS-CLIP	19536157
MIRT462818	hsa-miR-519a-3p	PAR-CLIP	23592263
MIRT462817	hsa-miR-519b-3p	PAR-CLIP	23592263
MIRT462816	hsa-miR-519c-3p	PAR-CLIP	23592263
MIRT462815	hsa-miR-6873-5p	PAR-CLIP	23592263
MIRT462814	hsa-miR-4779	PAR-CLIP	23592263
MIRT462813	hsa-miR-1321	PAR-CLIP	23592263
MIRT462811	hsa-miR-4739	PAR-CLIP	23592263
MIRT462812	hsa-miR-4756-5p	PAR-CLIP	23592263
MIRT462810	hsa-miR-6783-5p	PAR-CLIP	23592263
MIRT462809	hsa-miR-6805-5p	PAR-CLIP	23592263
MIRT462808	hsa-miR-4419a	PAR-CLIP	23592263
MIRT462807	hsa-miR-4510	PAR-CLIP	23592263
MIRT462806	hsa-miR-6127	PAR-CLIP	23592263
MIRT462805	hsa-miR-6129	PAR-CLIP	23592263
MIRT462804	hsa-miR-6130	PAR-CLIP	23592263
MIRT462803	hsa-miR-6133	PAR-CLIP	23592263
MIRT462802	hsa-miR-2467-3p	PAR-CLIP	23592263
MIRT462801	hsa-miR-765	PAR-CLIP	23592263
MIRT462800	hsa-miR-7106-5p	PAR-CLIP	23592263
MIRT462798	hsa-miR-4271	PAR-CLIP	23592263
MIRT462799	hsa-miR-4725-3p	PAR-CLIP	23592263
MIRT462797	hsa-miR-6780b-5p	PAR-CLIP	23592263
MIRT462796	hsa-miR-486-3p	PAR-CLIP	23592263
MIRT715335	hsa-miR-6769a-3p	HITS-CLIP	19536157
MIRT715334	hsa-miR-361-3p	HITS-CLIP	19536157
MIRT715333	hsa-miR-6887-3p	HITS-CLIP	19536157
MIRT715332	hsa-miR-1913	HITS-CLIP	19536157
MIRT715331	hsa-miR-324-3p	HITS-CLIP	19536157
MIRT715330	hsa-miR-4313	HITS-CLIP	19536157
MIRT715329	hsa-miR-4749-3p	HITS-CLIP	19536157
MIRT462818	hsa-miR-519a-3p	PAR-CLIP	23592263
MIRT462817	hsa-miR-519b-3p	PAR-CLIP	23592263
MIRT462816	hsa-miR-519c-3p	PAR-CLIP	23592263
MIRT462815	hsa-miR-6873-5p	PAR-CLIP	23592263
MIRT462814	hsa-miR-4779	PAR-CLIP	23592263
MIRT462813	hsa-miR-1321	PAR-CLIP	23592263
MIRT462811	hsa-miR-4739	PAR-CLIP	23592263
MIRT462812	hsa-miR-4756-5p	PAR-CLIP	23592263
MIRT462810	hsa-miR-6783-5p	PAR-CLIP	23592263
MIRT462809	hsa-miR-6805-5p	PAR-CLIP	23592263
MIRT462808	hsa-miR-4419a	PAR-CLIP	23592263
MIRT462807	hsa-miR-4510	PAR-CLIP	23592263
MIRT462806	hsa-miR-6127	PAR-CLIP	23592263
MIRT462805	hsa-miR-6129	PAR-CLIP	23592263
MIRT462804	hsa-miR-6130	PAR-CLIP	23592263
MIRT462803	hsa-miR-6133	PAR-CLIP	23592263
MIRT462802	hsa-miR-2467-3p	PAR-CLIP	23592263
MIRT462801	hsa-miR-765	PAR-CLIP	23592263
MIRT462800	hsa-miR-7106-5p	PAR-CLIP	23592263
MIRT462798	hsa-miR-4271	PAR-CLIP	23592263
MIRT462799	hsa-miR-4725-3p	PAR-CLIP	23592263
MIRT462797	hsa-miR-6780b-5p	PAR-CLIP	23592263
MIRT462796	hsa-miR-486-3p	PAR-CLIP	23592263
MIRT1196084	hsa-miR-103a	CLIP-seq
MIRT1196085	hsa-miR-106a	CLIP-seq
MIRT1196086	hsa-miR-106b	CLIP-seq
MIRT1196087	hsa-miR-107	CLIP-seq
MIRT1196088	hsa-miR-1197	CLIP-seq
MIRT1196089	hsa-miR-1254	CLIP-seq
MIRT1196090	hsa-miR-1282	CLIP-seq
MIRT1196091	hsa-miR-1286	CLIP-seq
MIRT1196092	hsa-miR-1301	CLIP-seq
MIRT1196093	hsa-miR-1307	CLIP-seq
MIRT1196094	hsa-miR-1471	CLIP-seq
MIRT1196095	hsa-miR-17	CLIP-seq
MIRT1196096	hsa-miR-188-3p	CLIP-seq
MIRT1196097	hsa-miR-1915	CLIP-seq
MIRT1196098	hsa-miR-1972	CLIP-seq
MIRT1196099	hsa-miR-204	CLIP-seq
MIRT1196100	hsa-miR-20a	CLIP-seq
MIRT1196101	hsa-miR-20b	CLIP-seq
MIRT1196102	hsa-miR-211	CLIP-seq
MIRT1196103	hsa-miR-2114	CLIP-seq
MIRT1196104	hsa-miR-299-3p	CLIP-seq
MIRT1196105	hsa-miR-3064-5p	CLIP-seq
MIRT1196106	hsa-miR-3116	CLIP-seq
MIRT1196107	hsa-miR-3122	CLIP-seq
MIRT1196108	hsa-miR-3145-5p	CLIP-seq
MIRT1196109	hsa-miR-3166	CLIP-seq
MIRT1196110	hsa-miR-3184	CLIP-seq
MIRT1196111	hsa-miR-3189-3p	CLIP-seq
MIRT1196112	hsa-miR-3192	CLIP-seq
MIRT1196113	hsa-miR-339-5p	CLIP-seq
MIRT1196114	hsa-miR-3609	CLIP-seq
MIRT1196115	hsa-miR-3689a-3p	CLIP-seq
MIRT1196116	hsa-miR-3689c	CLIP-seq
MIRT1196117	hsa-miR-3691-3p	CLIP-seq
MIRT1196118	hsa-miR-3913-5p	CLIP-seq
MIRT1196119	hsa-miR-423-5p	CLIP-seq
MIRT1196120	hsa-miR-4278	CLIP-seq
MIRT1196121	hsa-miR-4297	CLIP-seq
MIRT1196122	hsa-miR-4300	CLIP-seq
MIRT1196123	hsa-miR-4436a	CLIP-seq
MIRT1196124	hsa-miR-4459	CLIP-seq
MIRT1196125	hsa-miR-4467	CLIP-seq
MIRT1196126	hsa-miR-4468	CLIP-seq
MIRT1196127	hsa-miR-4496	CLIP-seq
MIRT1196128	hsa-miR-450a	CLIP-seq
MIRT1196129	hsa-miR-4519	CLIP-seq
MIRT1196130	hsa-miR-4643	CLIP-seq
MIRT1196131	hsa-miR-4650-5p	CLIP-seq
MIRT1196132	hsa-miR-466	CLIP-seq
MIRT1196133	hsa-miR-4685-5p	CLIP-seq
MIRT1196134	hsa-miR-4688	CLIP-seq
MIRT1196135	hsa-miR-4695-5p	CLIP-seq
MIRT1196136	hsa-miR-4707-3p	CLIP-seq
MIRT1196137	hsa-miR-4716-3p	CLIP-seq
MIRT1196138	hsa-miR-4725-5p	CLIP-seq
MIRT1196139	hsa-miR-4728-5p	CLIP-seq
MIRT1196140	hsa-miR-4755-5p	CLIP-seq
MIRT1196141	hsa-miR-4771	CLIP-seq
MIRT1196142	hsa-miR-4780	CLIP-seq
MIRT1196143	hsa-miR-4789-3p	CLIP-seq
MIRT1196144	hsa-miR-4796-3p	CLIP-seq
MIRT1196145	hsa-miR-504	CLIP-seq
MIRT1196146	hsa-miR-5047	CLIP-seq
MIRT1196147	hsa-miR-515-3p	CLIP-seq
MIRT1196148	hsa-miR-519a	CLIP-seq
MIRT1196149	hsa-miR-519d	CLIP-seq
MIRT1196150	hsa-miR-519e	CLIP-seq
MIRT1196151	hsa-miR-548ah	CLIP-seq
MIRT1196152	hsa-miR-550a	CLIP-seq
MIRT1196153	hsa-miR-555	CLIP-seq
MIRT1196154	hsa-miR-603	CLIP-seq
MIRT1196155	hsa-miR-623	CLIP-seq
MIRT1196156	hsa-miR-635	CLIP-seq
MIRT1196157	hsa-miR-640	CLIP-seq
MIRT1196158	hsa-miR-661	CLIP-seq
MIRT1196159	hsa-miR-665	CLIP-seq
MIRT1196160	hsa-miR-892b	CLIP-seq
MIRT1196161	hsa-miR-920	CLIP-seq
MIRT1196162	hsa-miR-93	CLIP-seq
MIRT1196085	hsa-miR-106a	CLIP-seq
MIRT1196086	hsa-miR-106b	CLIP-seq
MIRT2056888	hsa-miR-1200	CLIP-seq
MIRT1196089	hsa-miR-1254	CLIP-seq
MIRT2056889	hsa-miR-1266	CLIP-seq
MIRT2056890	hsa-miR-1273e	CLIP-seq
MIRT2056891	hsa-miR-1294	CLIP-seq
MIRT1196093	hsa-miR-1307	CLIP-seq
MIRT2056892	hsa-miR-1587	CLIP-seq
MIRT2056893	hsa-miR-15a	CLIP-seq
MIRT2056894	hsa-miR-15b	CLIP-seq
MIRT2056895	hsa-miR-16	CLIP-seq
MIRT1196095	hsa-miR-17	CLIP-seq
MIRT2056896	hsa-miR-1827	CLIP-seq
MIRT2056897	hsa-miR-1909	CLIP-seq
MIRT2056898	hsa-miR-195	CLIP-seq
MIRT1196100	hsa-miR-20a	CLIP-seq
MIRT1196101	hsa-miR-20b	CLIP-seq
MIRT2056899	hsa-miR-2110	CLIP-seq
MIRT2056900	hsa-miR-214	CLIP-seq
MIRT2056901	hsa-miR-2277-3p	CLIP-seq
MIRT2056902	hsa-miR-296-5p	CLIP-seq
MIRT1196104	hsa-miR-299-3p	CLIP-seq
MIRT2056903	hsa-miR-3074-5p	CLIP-seq
MIRT1196106	hsa-miR-3116	CLIP-seq
MIRT2056904	hsa-miR-3124-3p	CLIP-seq
MIRT2056905	hsa-miR-3140-5p	CLIP-seq
MIRT2056906	hsa-miR-3153	CLIP-seq
MIRT1196110	hsa-miR-3184	CLIP-seq
MIRT1196111	hsa-miR-3189-3p	CLIP-seq
MIRT1196114	hsa-miR-3609	CLIP-seq
MIRT2056907	hsa-miR-3619-5p	CLIP-seq
MIRT2056908	hsa-miR-3665	CLIP-seq
MIRT2056909	hsa-miR-378g	CLIP-seq
MIRT2056910	hsa-miR-3907	CLIP-seq
MIRT1196119	hsa-miR-423-5p	CLIP-seq
MIRT2056911	hsa-miR-424	CLIP-seq
MIRT2056912	hsa-miR-4267	CLIP-seq
MIRT1196122	hsa-miR-4300	CLIP-seq
MIRT2056913	hsa-miR-4308	CLIP-seq
MIRT2056914	hsa-miR-4316	CLIP-seq
MIRT2056915	hsa-miR-4417	CLIP-seq
MIRT2056916	hsa-miR-4492	CLIP-seq
MIRT1196127	hsa-miR-4496	CLIP-seq
MIRT2056917	hsa-miR-4498	CLIP-seq
MIRT2056918	hsa-miR-4505	CLIP-seq
MIRT2056919	hsa-miR-4514	CLIP-seq
MIRT2056920	hsa-miR-4518	CLIP-seq
MIRT1196131	hsa-miR-4650-5p	CLIP-seq
MIRT2056921	hsa-miR-4652-5p	CLIP-seq
MIRT2056922	hsa-miR-4655-5p	CLIP-seq
MIRT2056923	hsa-miR-4656	CLIP-seq
MIRT2056924	hsa-miR-4660	CLIP-seq
MIRT2056925	hsa-miR-4675	CLIP-seq
MIRT2056926	hsa-miR-4692	CLIP-seq
MIRT2056927	hsa-miR-4694-3p	CLIP-seq
MIRT1196136	hsa-miR-4707-3p	CLIP-seq
MIRT2056928	hsa-miR-4741	CLIP-seq
MIRT2056929	hsa-miR-4747-5p	CLIP-seq
MIRT2056930	hsa-miR-4755-3p	CLIP-seq
MIRT2056931	hsa-miR-4786-3p	CLIP-seq
MIRT1196144	hsa-miR-4796-3p	CLIP-seq
MIRT2056932	hsa-miR-497	CLIP-seq
MIRT1196147	hsa-miR-515-3p	CLIP-seq
MIRT1196149	hsa-miR-519d	CLIP-seq
MIRT1196150	hsa-miR-519e	CLIP-seq
MIRT2056933	hsa-miR-522	CLIP-seq
MIRT2056934	hsa-miR-541	CLIP-seq
MIRT1196151	hsa-miR-548ah	CLIP-seq
MIRT1196152	hsa-miR-550a	CLIP-seq
MIRT2056935	hsa-miR-566	CLIP-seq
MIRT2056936	hsa-miR-595	CLIP-seq
MIRT2056937	hsa-miR-617	CLIP-seq
MIRT1196156	hsa-miR-635	CLIP-seq
MIRT2056938	hsa-miR-646	CLIP-seq
MIRT2056939	hsa-miR-654-5p	CLIP-seq
MIRT2056940	hsa-miR-658	CLIP-seq
MIRT1196158	hsa-miR-661	CLIP-seq
MIRT2056941	hsa-miR-671-5p	CLIP-seq
MIRT2056942	hsa-miR-761	CLIP-seq
MIRT2056943	hsa-miR-762	CLIP-seq
MIRT2056944	hsa-miR-764	CLIP-seq
MIRT2056945	hsa-miR-885-3p	CLIP-seq
MIRT1196161	hsa-miR-920	CLIP-seq
MIRT1196162	hsa-miR-93	CLIP-seq
MIRT2056946	hsa-miR-943	CLIP-seq
MIRT2285352	hsa-miR-105	CLIP-seq
MIRT1196088	hsa-miR-1197	CLIP-seq
MIRT2285353	hsa-miR-1207-5p	CLIP-seq
MIRT2056891	hsa-miR-1294	CLIP-seq
MIRT2285354	hsa-miR-1470	CLIP-seq
MIRT2056892	hsa-miR-1587	CLIP-seq
MIRT2056893	hsa-miR-15a	CLIP-seq
MIRT2056894	hsa-miR-15b	CLIP-seq
MIRT2056895	hsa-miR-16	CLIP-seq
MIRT2056896	hsa-miR-1827	CLIP-seq
MIRT2285355	hsa-miR-188-5p	CLIP-seq
MIRT2056897	hsa-miR-1909	CLIP-seq
MIRT2056898	hsa-miR-195	CLIP-seq
MIRT2056900	hsa-miR-214	CLIP-seq
MIRT2285356	hsa-miR-2682	CLIP-seq
MIRT2056902	hsa-miR-296-5p	CLIP-seq
MIRT2056907	hsa-miR-3619-5p	CLIP-seq
MIRT2285357	hsa-miR-3663-3p	CLIP-seq
MIRT2056908	hsa-miR-3665	CLIP-seq
MIRT2285358	hsa-miR-3667-3p	CLIP-seq
MIRT2056909	hsa-miR-378g	CLIP-seq
MIRT2056910	hsa-miR-3907	CLIP-seq
MIRT2056911	hsa-miR-424	CLIP-seq
MIRT2285359	hsa-miR-4292	CLIP-seq
MIRT2056913	hsa-miR-4308	CLIP-seq
MIRT2056914	hsa-miR-4316	CLIP-seq
MIRT2285360	hsa-miR-4469	CLIP-seq
MIRT2056916	hsa-miR-4492	CLIP-seq
MIRT2056917	hsa-miR-4498	CLIP-seq
MIRT2285361	hsa-miR-449c	CLIP-seq
MIRT2056919	hsa-miR-4514	CLIP-seq
MIRT2285362	hsa-miR-4640-5p	CLIP-seq
MIRT2056923	hsa-miR-4656	CLIP-seq
MIRT2285363	hsa-miR-4667-3p	CLIP-seq
MIRT2056925	hsa-miR-4675	CLIP-seq
MIRT1196133	hsa-miR-4685-5p	CLIP-seq
MIRT1196134	hsa-miR-4688	CLIP-seq
MIRT2056926	hsa-miR-4692	CLIP-seq
MIRT2056927	hsa-miR-4694-3p	CLIP-seq
MIRT1196136	hsa-miR-4707-3p	CLIP-seq
MIRT1196138	hsa-miR-4725-5p	CLIP-seq
MIRT2285364	hsa-miR-4726-5p	CLIP-seq
MIRT2056928	hsa-miR-4741	CLIP-seq
MIRT2285365	hsa-miR-4763-3p	CLIP-seq
MIRT2056932	hsa-miR-497	CLIP-seq
MIRT1196145	hsa-miR-504	CLIP-seq
MIRT2056933	hsa-miR-522	CLIP-seq
MIRT2285366	hsa-miR-596	CLIP-seq
MIRT2056942	hsa-miR-761	CLIP-seq
MIRT2056943	hsa-miR-762	CLIP-seq
MIRT2056944	hsa-miR-764	CLIP-seq
MIRT2285367	hsa-miR-937	CLIP-seq
MIRT1196093	hsa-miR-1307	CLIP-seq
MIRT2056900	hsa-miR-214	CLIP-seq
MIRT2056907	hsa-miR-3619-5p	CLIP-seq
MIRT2056908	hsa-miR-3665	CLIP-seq
MIRT2056910	hsa-miR-3907	CLIP-seq
MIRT2056927	hsa-miR-4694-3p	CLIP-seq
MIRT1196136	hsa-miR-4707-3p	CLIP-seq
MIRT2056933	hsa-miR-522	CLIP-seq
MIRT2056935	hsa-miR-566	CLIP-seq
MIRT2056942	hsa-miR-761	CLIP-seq
MIRT2056944	hsa-miR-764	CLIP-seq
MIRT2583451	hsa-miR-1185	CLIP-seq
MIRT2583452	hsa-miR-1265	CLIP-seq
MIRT2056891	hsa-miR-1294	CLIP-seq
MIRT2583453	hsa-miR-1538	CLIP-seq
MIRT1196104	hsa-miR-299-3p	CLIP-seq
MIRT2583454	hsa-miR-3605-5p	CLIP-seq
MIRT2583455	hsa-miR-3679-5p	CLIP-seq
MIRT2583456	hsa-miR-4265	CLIP-seq
MIRT2583457	hsa-miR-4296	CLIP-seq
MIRT2056914	hsa-miR-4316	CLIP-seq
MIRT2583458	hsa-miR-4322	CLIP-seq
MIRT2056915	hsa-miR-4417	CLIP-seq
MIRT2285362	hsa-miR-4640-5p	CLIP-seq
MIRT2285364	hsa-miR-4726-5p	CLIP-seq
MIRT2583459	hsa-miR-4745-3p	CLIP-seq
MIRT2583460	hsa-miR-4747-3p	CLIP-seq
MIRT2583461	hsa-miR-4764-5p	CLIP-seq
MIRT2583451	hsa-miR-1185	CLIP-seq
MIRT2583452	hsa-miR-1265	CLIP-seq
MIRT2056891	hsa-miR-1294	CLIP-seq
MIRT2583453	hsa-miR-1538	CLIP-seq
MIRT1196104	hsa-miR-299-3p	CLIP-seq
MIRT2583454	hsa-miR-3605-5p	CLIP-seq
MIRT2583455	hsa-miR-3679-5p	CLIP-seq
MIRT2583456	hsa-miR-4265	CLIP-seq
MIRT2583457	hsa-miR-4296	CLIP-seq
MIRT2056914	hsa-miR-4316	CLIP-seq
MIRT2583458	hsa-miR-4322	CLIP-seq
MIRT2056915	hsa-miR-4417	CLIP-seq
MIRT2285362	hsa-miR-4640-5p	CLIP-seq
MIRT2285364	hsa-miR-4726-5p	CLIP-seq
MIRT2583459	hsa-miR-4745-3p	CLIP-seq
MIRT2583460	hsa-miR-4747-3p	CLIP-seq
MIRT2583461	hsa-miR-4764-5p	CLIP-seq

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000978	Function	RNA polymerase II cis-regulatory region sequence-specific DNA binding	IBA
GO:0000981	Function	DNA-binding transcription factor activity, RNA polymerase II-specific	IBA
GO:0001764	Process	Neuron migration	IEA
GO:0005515	Function	Protein binding	IPI	10102268, 19196994, 19721007, 20434207, 26190107, 28501620
GO:0005576	Component	Extracellular region	IDA	28945198
GO:0005576	Component	Extracellular region	IEA
GO:0005576	Component	Extracellular region	TAS
GO:0005604	Component	Basement membrane	IEA
GO:0005654	Component	Nucleoplasm	IDA
GO:0005737	Component	Cytoplasm	IEA
GO:0005829	Component	Cytosol	IDA
GO:0006357	Process	Regulation of transcription by RNA polymerase II	IBA
GO:0006915	Process	Apoptotic process	IEA
GO:0006930	Process	Substrate-dependent cell migration, cell extension	ISS
GO:0007097	Process	Nuclear migration	IEA
GO:0007265	Process	Ras protein signal transduction	ISS
GO:0007409	Process	Axonogenesis	IEA
GO:0007411	Process	Axon guidance	IEA
GO:0008283	Process	Cell population proliferation	IEA
GO:0014009	Process	Glial cell proliferation	IEA
GO:0015629	Component	Actin cytoskeleton	IDA
GO:0030334	Process	Regulation of cell migration	IEA
GO:0030517	Process	Negative regulation of axon extension	IEA
GO:0030879	Process	Mammary gland development	IEA
GO:0032488	Process	Cdc42 protein signal transduction	ISS
GO:0033564	Process	Anterior/posterior axon guidance	IEA
GO:0042472	Process	Inner ear morphogenesis	IEA
GO:0045202	Component	Synapse	IEA
GO:0045773	Process	Positive regulation of axon extension	IEA
GO:0045773	Process	Positive regulation of axon extension	ISS
GO:0051963	Process	Regulation of synapse assembly	IEA
GO:0060252	Process	Positive regulation of glial cell proliferation	IEA
GO:0060603	Process	Mammary gland duct morphogenesis	IEA
GO:0061643	Process	Chemorepulsion of axon	IEA
GO:0061643	Process	Chemorepulsion of axon	ISS
GO:0097475	Process	Motor neuron migration	IEA
GO:0098609	Process	Cell-cell adhesion	IEA
GO:0098978	Component	Glutamatergic synapse	IEA
GO:1903975	Process	Regulation of glial cell migration	IEA
GO:2000147	Process	Positive regulation of cell motility	ISS

Other IDs

• MIM: 601614
• HGNC: 8029
• e!Ensembl: ENSG00000065320

Protein

• UniProt ID: O95631
• Protein name: Netrin-1 (Epididymis tissue protein Li 131P)
• Protein function: Netrins control guidance of CNS commissural axons and peripheral motor axons. Its association with either DCC or some UNC5 receptors will lead to axon attraction or repulsion, respectively. Binding to UNC5C might cause dissociation of UNC5C from
• PDB: 4URT, 6FKQ, 7NDG, 7NE0, 7NE1
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00055	Laminin_N	51 → 283	Laminin N-terminal (Domain VI)	Family
  PF00053	Laminin_EGF	285 → 338	Laminin EGF domain	Domain
  PF00053	Laminin_EGF	341 → 401	Laminin EGF domain	Domain
  PF00053	Laminin_EGF	404 → 451	Laminin EGF domain	Domain
  PF01759	NTR	488 → 594	UNC-6/NTR/C345C module	Domain

• Tissue specificity: TISSUE SPECIFICITY: Widely expressed in normal adult tissues with highest levels in heart, small intestine, colon, liver and prostate. Reduced expression in brain tumors and neuroblastomas. Expressed in epididymis (at protein level). {ECO:0000269|PubMed:2
• Sequence:

  MMRAVWEALAALAAVACLVGAVRGGPGLSMFAGQAAQPDPCSDENGHPRRCIPDFVNAAF
  GKDVRVSSTCGRPPARYCVVSERGEERLRSCHLCNASDPKKAHPPAFLTDLNNPHNLTCW
  QSENYLQFPHNVTLTLSLGKKFEVTYVSLQFCSPRPESMAIYKSMDYGRTWVPFQFYSTQ
  CRKMYNRPHRAPITKQNEQEAVCTDSHTDMRPLSGGLIAFSTLDGRPSAHDFDNSPVLQD
  WVTATDIRVAFSRLHTFGDENEDDSELARDSYFYAVSDLQVGGRCKCNGHAARCVRDRDD
  SLVCDCRHNTAGPECDRCKPFHYDRPWQRATAREANECVACNCNLHARRCRFNMELYKLS
  GRKSGGVCLNCRHNTAGRHCHYCKEGYYRDMGKPITHRKACKACDCHPVGAAGKTCNQTT
  GQCPCKDGVTGITCNRCAKGYQQSRSPIAPCIKIPVAPPTTAASSVEEPEDCDSYCKASK
  GKLKINMKKYCKKDYAVQIHILKADKAGDWWKFTVNIISVYKQGTSRIRRGDQSLWIRSR
  DIACKCPKIKPLKKYLLLGNAEDSPDQSGIVADKSSLVIQWRDTWARRLRKFQQREKKGK
  CKKA

• Sequence length: 604

Pathways

KEGG:

Axon guidance

Reactome:

Netrin-1 signaling
DCC mediated attractive signaling

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Causal
Phenotype Name	Clinical Significance	dbSNP ID	RCV Accession	Evidence Score
Mirror movements 4	Pathogenic	rs1567750186, rs1567749982, rs1567750187	RCV000735954 RCV000735955 RCV000735956	★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
ATYPICAL FEMORAL FRACTURE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BRAIN EDEMA	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BREAST CARCINOMA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CENTRAL NERVOUS SYSTEM CANCER	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
COLOR VISION DISORDER	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
FAMILIAL CONGENITAL MIRROR MOVEMENTS	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
GLIOBLASTOMA MULTIFORME	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
GLIOMA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
GRAVES DISEASE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Malignant tumor of esophagus	Likely benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MIRROR MOVEMENT DISORDER	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MIRROR MOVEMENTS 1	—	CTD, ClinVar, HPO CTD, ClinVar, HPO CTD, ClinVar, HPO	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
NEUROTIC DISORDER	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Nonsyndromic cleft lip with or without cleft palate	Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
NTN1-related disorder	Likely benign; Uncertain significance; Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OLIGODENDROGLIOMA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OROFACIAL CLEFT	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Orofacial cleft 1	Uncertain significance	ClinVar Disgenet	★★★☆☆ Reported in Unknown/Other Associations (≥2 sources)
Ovarian serous cystadenocarcinoma	Likely benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Adenocarcinoma of pancreas	Pancreatic adenocarcinoma	BEFREE	27034160		★☆☆☆☆ Found in Text Mining only
Adult Medulloblastoma	Medulloblastoma	BEFREE	24812271		★☆☆☆☆ Found in Text Mining only
Agenesis of corpus callosum	Agenesis Of Corpus Callosum	HPO_DG			★☆☆☆☆ Found in Text Mining only
Alzheimer Disease	Alzheimer disease	Pubtator	32711556	Associate	★☆☆☆☆ Found in Text Mining only
Amnesia	Amnesia	BEFREE	30804256		★☆☆☆☆ Found in Text Mining only
ANOPHTHALMIA AND PULMONARY HYPOPLASIA	Syndromic microphthalmia	BEFREE	27034160		★☆☆☆☆ Found in Text Mining only
Aortic Aneurysm	Aortic Aneurysm	BEFREE	31035427		★☆☆☆☆ Found in Text Mining only
Aortic Aneurysm Thoracic	Thoracic aortic aneurysm	Pubtator	31035427	Associate	★☆☆☆☆ Found in Text Mining only
Aortic Aneurysm, Abdominal	Aortic Aneurysm	BEFREE	30479344		★☆☆☆☆ Found in Text Mining only
Arteriosclerosis	Arteriosclerosis	BEFREE	22231519, 23599441, 24122613, 24262644, 31801376		★☆☆☆☆ Found in Text Mining only
Arthritis Rheumatoid	Rheumatoid arthritis	Pubtator	19822088	Inhibit	★☆☆☆☆ Found in Text Mining only
Atherosclerosis	Atherosclerosis	BEFREE	22231519, 23599441, 24122613, 24262644, 31801376		★☆☆☆☆ Found in Text Mining only
Atherosclerosis	Atherosclerosis	Pubtator	32151395, 32317107	Associate	★☆☆☆☆ Found in Text Mining only
Benign Neoplasm	Benign Neoplasm	BEFREE	21789787		★☆☆☆☆ Found in Text Mining only
beta Thalassemia	Beta thalassemia	Pubtator	33715293	Stimulate	★☆☆☆☆ Found in Text Mining only
Bipolar Disorder	Bipolar disorder	Pubtator	40597885	Associate	★☆☆☆☆ Found in Text Mining only
Bladder Neoplasm	Bladder Neoplasm	BEFREE	29328435		★☆☆☆☆ Found in Text Mining only
Brain Ischemia	Cerebral Ischemia	BEFREE	30227858		★☆☆☆☆ Found in Text Mining only
Brain Neoplasms	Brain neoplasms	Pubtator	24647424	Associate	★☆☆☆☆ Found in Text Mining only
Brain Neoplasms	Brain Neoplasms	BEFREE	9950216		★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	30429890		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Breast Neoplasms	Breast neoplasm	Pubtator	23319801, 27378792	Associate	★☆☆☆☆ Found in Text Mining only
Carcinogenesis	Carcinogenesis	Pubtator	24647424, 27031829, 35489200	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma	Carcinoma	BEFREE	27815019		★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	27031829	Stimulate	★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	27420970	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma of bladder	Bladder carcinoma	BEFREE	29328435		★☆☆☆☆ Found in Text Mining only
Carcinoma of lung	Lung carcinoma	BEFREE	19211441, 30968155		★☆☆☆☆ Found in Text Mining only
Carcinoma, Basal Cell	Carcinoma	BEFREE	29137400		★☆☆☆☆ Found in Text Mining only
Carcinoma, Ovarian Epithelial	Ovarian Epithelial carcinoma	BEFREE	28475012		★☆☆☆☆ Found in Text Mining only
Cardiovascular Diseases	Cardiovascular Diseases	BEFREE	21622818, 24262644, 24827071		★☆☆☆☆ Found in Text Mining only
Cartilage-hair hypoplasia	Cartilage-Hair Hypoplasia	BEFREE	29202173		★☆☆☆☆ Found in Text Mining only
Cerebral Infarction	Cerebral Infarction	BEFREE	29487502, 30227858, 30797642		★☆☆☆☆ Found in Text Mining only
Cerebral Palsy	Cerebral palsy	HPO_DG			★☆☆☆☆ Found in Text Mining only
Cerebrovascular accident	Stroke	BEFREE	28084632, 29017609, 29487502, 30852966		★☆☆☆☆ Found in Text Mining only
Childhood Medulloblastoma	Medulloblastoma	BEFREE	24812271		★☆☆☆☆ Found in Text Mining only
Chronic Kidney Diseases	Kidney Disease	BEFREE	24991088		★☆☆☆☆ Found in Text Mining only
Cleft Lip	Cleft lip	Pubtator	35191549	Associate	★☆☆☆☆ Found in Text Mining only
Cleft Lip with or without Cleft Palate	Cleft Lip With Or Without Cleft Palate	BEFREE	31780810		★☆☆☆☆ Found in Text Mining only
Cleft Palate	Cleft palate	Pubtator	23512105, 27734840, 30638414, 31122291, 35191549	Associate	★☆☆☆☆ Found in Text Mining only
Cognition Disorders	Cognitive disorder	BEFREE	31191297		★☆☆☆☆ Found in Text Mining only
Colitis	Colitis	BEFREE	24720832		★☆☆☆☆ Found in Text Mining only
Colon Carcinoma	Colon Carcinoma	BEFREE	18054557		★☆☆☆☆ Found in Text Mining only
Colonic Neoplasms	Colonic Neoplasms	BEFREE	17334389		★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	15956977, 16762451, 17690130, 18054557, 18692059, 19242752, 19721007, 22158121, 28526701, 29017609, 29377591, 29801399, 29912942, 30811036		★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal Neoplasms	LHGDN	16181408, 18253061		★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	18054557, 21893118, 26039999, 34470826, 37568074, 39261771	Associate	★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal Neoplasms	BEFREE	18692059, 21893118		★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	35489200	Inhibit	★☆☆☆☆ Found in Text Mining only
Congenital hypogonadotropic hypogonadism	Congenital Hypogonadotropic Hypogonadism	BEFREE	29202173		★☆☆☆☆ Found in Text Mining only
Conventional (Clear Cell) Renal Cell Carcinoma	Renal Carcinoma	BEFREE	23526078		★☆☆☆☆ Found in Text Mining only
Corneal Neovascularization	Corneal Neovascularization	BEFREE	25853509		★☆☆☆☆ Found in Text Mining only
Coronary Arteriosclerosis	Coronary Arteriosclerosis	BEFREE	24122613, 27727089		★☆☆☆☆ Found in Text Mining only
Coronary Artery Disease	Coronary artery disease	BEFREE	24122613, 27727089, 31464731		★☆☆☆☆ Found in Text Mining only
Coronary Artery Disease	Coronary artery disease	Pubtator	27727089	Associate	★☆☆☆☆ Found in Text Mining only
Coronary heart disease	Coronary Heart Disease	BEFREE	24122613, 27727089		★☆☆☆☆ Found in Text Mining only
Degenerative polyarthritis	Arthritis	BEFREE	19822088, 30530994		★☆☆☆☆ Found in Text Mining only
Depressive disorder	Mental Depression	BEFREE	29234153, 31659271		★☆☆☆☆ Found in Text Mining only
Dermatologic disorders	Dermatologic Disorders	BEFREE	31012327		★☆☆☆☆ Found in Text Mining only
Diabetes	Diabetes	BEFREE	24827071, 27400127, 27520508, 29059224, 31219796		★☆☆☆☆ Found in Text Mining only
Diabetes Gestational	Gestational diabetes	Pubtator	30897795	Associate	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes Mellitus	BEFREE	24827071, 27400127, 27520508, 28250059, 29059224, 31219796		★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus Type 2	Diabetes mellitus, type 2	Pubtator	36297056	Associate	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Insulin-Dependent	Diabetes Mellitus	BEFREE	31219796		★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Non-Insulin-Dependent	Diabetes Mellitus	BEFREE	29314827, 30532735, 31846437		★☆☆☆☆ Found in Text Mining only
Diabetic Foot	Diabetic foot	Pubtator	40176590	Associate	★☆☆☆☆ Found in Text Mining only
Diabetic Nephropathies	Diabetic neuropathy	Pubtator	38033740	Associate	★☆☆☆☆ Found in Text Mining only
Diabetic Nephropathy	Diabetic Nephropathy	BEFREE	28704853		★☆☆☆☆ Found in Text Mining only
Diabetic Retinopathy	Diabetic Retinopathy	BEFREE	27400127, 28715647		★☆☆☆☆ Found in Text Mining only
Down Syndrome	Down Syndrome	BEFREE	29718256		★☆☆☆☆ Found in Text Mining only
Dysgenesis of the hippocampus	Dysgenesis of the hippocampus	HPO_DG			★☆☆☆☆ Found in Text Mining only
Dyslexia	Dyslexia	Pubtator	27734840	Associate	★☆☆☆☆ Found in Text Mining only
Encephalitis	Encephalitis	BEFREE	30981282		★☆☆☆☆ Found in Text Mining only
Endometrial Carcinoma	Endometrial carcinoma	BEFREE	15491747		★☆☆☆☆ Found in Text Mining only
Familial congenital mirror movements	Congenital Mirror Movements	Orphanet			★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Fatty Liver	Fatty liver	Pubtator	29985430	Associate	★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	Pubtator	21980448, 27651158	Associate	★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	BEFREE	23549787, 27651158, 28069038		★☆☆☆☆ Found in Text Mining only
Glioblastoma Multiforme	Glioblastoma	BEFREE	23549787, 27651158, 28069038		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Glioma	Glioma	BEFREE	28069038, 28710382		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Glycosuria Renal	Renal glycosuria	Pubtator	38033740	Associate	★☆☆☆☆ Found in Text Mining only
Graft vs Host Disease	Graft-versus-host disease	Pubtator	26039999	Associate	★☆☆☆☆ Found in Text Mining only
Hepatitis C	Hepatitis c	Pubtator	27031829	Associate	★☆☆☆☆ Found in Text Mining only
Hodgkin Disease	Hodgkin disease	Pubtator	40235169	Associate	★☆☆☆☆ Found in Text Mining only
Huntington Disease	Huntington disease	Pubtator	26651603	Associate	★☆☆☆☆ Found in Text Mining only
Hyperinsulinism	Hyperinsulinism	BEFREE	27520508		★☆☆☆☆ Found in Text Mining only
Hypertensive disease	Hypertension	BEFREE	31219796		★☆☆☆☆ Found in Text Mining only
Hypogonadotropic hypogonadism	Hypogonadotropic Hypogonadism	HPO_DG			★☆☆☆☆ Found in Text Mining only
Hypoxia	Hypoxia	Pubtator	36297056	Stimulate	★☆☆☆☆ Found in Text Mining only
Impaired cognition	Impaired Cognition	BEFREE	30066400, 31191297		★☆☆☆☆ Found in Text Mining only
Inflammatory Bowel Diseases	Inflammatory Bowel Disease	BEFREE	19721007		★☆☆☆☆ Found in Text Mining only
Insulin Resistance	Diabetes mellitus, type 2	Pubtator	36297056	Associate	★☆☆☆☆ Found in Text Mining only
Intestinal Cancer	Intestinal Cancer	BEFREE	31806640		★☆☆☆☆ Found in Text Mining only
Intestinal Neoplasms	Intestinal Neoplasms	BEFREE	21893118		★☆☆☆☆ Found in Text Mining only
Isaacs syndrome	Isaacs Syndrome	BEFREE	28251919, 28682959, 30714278		★☆☆☆☆ Found in Text Mining only
Ischemic stroke	Ischemic Stroke	BEFREE	29311781, 30797642, 30852966		★☆☆☆☆ Found in Text Mining only
Kallmann Syndrome	Kallmann Syndrome	BEFREE	29202173		★☆☆☆☆ Found in Text Mining only
Kidney Diseases	Kidney Disease	BEFREE	28250059		★☆☆☆☆ Found in Text Mining only
Kidney Diseases	Kidney disease	Pubtator	33715293	Associate	★☆☆☆☆ Found in Text Mining only
Kidney Failure, Acute	Kidney Failure	BEFREE	21625583		★☆☆☆☆ Found in Text Mining only
Kidney Neoplasms	Kidney neoplasm	Pubtator	23526078	Associate	★☆☆☆☆ Found in Text Mining only
Leukemia Myeloid Acute	Myeloid leukemia	Pubtator	37038247	Associate	★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	24442237, 29277614		★☆☆☆☆ Found in Text Mining only
Liver Cirrhosis	Liver cirrhosis	Pubtator	27031829	Stimulate	★☆☆☆☆ Found in Text Mining only
Lung Diseases, Interstitial	Lung Diseases	BEFREE	26749424		★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung Neoplasms	BEFREE	19211441		★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung Neoplasms	LHGDN	19211441		★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung neoplasms	Pubtator	35765995	Associate	★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic metastasis	Pubtator	39261771	Associate	★☆☆☆☆ Found in Text Mining only
Macular Degeneration	Macular degeneration	Pubtator	25950802	Associate	★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	18353983, 30429890		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of endometrium	Endometrial Cancer	BEFREE	15491747		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of liver	Liver Cancer	BEFREE	31407237		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of lung	Lung Cancer	BEFREE	19211441, 30968155		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of ovary	Ovarian cancer	BEFREE	28475012		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of pancreas	Pancreatic cancer	BEFREE	27034160		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	BEFREE	27815019		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of stomach	Stomach Neoplasms	BEFREE	29305865, 30106432, 31289590		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of urinary bladder	Urinary bladder cancer	BEFREE	29328435		★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	15491747, 17334389, 17967459, 18054557, 21789787, 24293316, 24442237, 24647424, 27793362, 28069038, 28443497, 28710382, 28783179, 29305865, 30106432, 30429890, 30968155, 31088838, 31289590, 31806640		★☆☆☆☆ Found in Text Mining only
Malignant tumor of colon	Colonic Neoplasms	BEFREE	18054557, 19242752		★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	BEFREE	18353983, 30429890		★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	LHGDN	18353983		★☆☆☆☆ Found in Text Mining only
Medulloblastoma	Medulloblastoma	BEFREE	24812271		★☆☆☆☆ Found in Text Mining only
Medulloblastoma	Medulloblastoma	Pubtator	24812271	Associate	★☆☆☆☆ Found in Text Mining only
melanoma	Melanoma	BEFREE	19940358, 31806640		★☆☆☆☆ Found in Text Mining only
Melanoma	Melanoma	Pubtator	19940358, 34470826, 36361539	Associate	★☆☆☆☆ Found in Text Mining only
Mental Depression	Mental Depression	BEFREE	29234153, 31659271		★☆☆☆☆ Found in Text Mining only
Mental disorders	Mental Disorders	BEFREE	31659271		★☆☆☆☆ Found in Text Mining only
Mild Mental Retardation	Mental retardation	HPO_DG			★☆☆☆☆ Found in Text Mining only
MIRROR MOVEMENTS 4	Mirror movements	UNIPROT_DG	28945198		★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
MIRROR MOVEMENTS 4	Mirror movements	CLINVAR_DG			★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Mirror movements disorder	Mirror Movements	BEFREE	28945198		★☆☆☆☆ Found in Text Mining only
Mirror movements disorder	Mirror Movements	HPO_DG			★☆☆☆☆ Found in Text Mining only
Mitochondrial Diseases	Mitochondrial disease	Pubtator	32711556	Associate	★☆☆☆☆ Found in Text Mining only
Multiple Sclerosis	Multiple Sclerosis	BEFREE	25903786, 28677863		★☆☆☆☆ Found in Text Mining only
Myasthenia Gravis	Myasthenia Gravis	BEFREE	28251919		★☆☆☆☆ Found in Text Mining only
Myocardial Infarction	Myocardial Infarction	BEFREE	24827071, 25561546, 28250059, 30789913		★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	10719364, 12655055, 16762451, 17018594, 18353983, 18692059, 19211441, 19242752, 19349462, 21789787, 22871610, 23526078, 24293316, 24812271, 27651158, 27793362, 28038459, 28069038, 28443497, 28475012, 28710382, 30106432, 30429890, 30532711, 30968155, 31088838, 31806640		★☆☆☆☆ Found in Text Mining only
nervous system disorder	Nervous System Disorder	BEFREE	29162556		★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	BEFREE	19349462, 28038459, 9950216		★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	Pubtator	19349462	Associate	★☆☆☆☆ Found in Text Mining only
Neuropathy	Neuropathy	BEFREE	31392393		★☆☆☆☆ Found in Text Mining only
Non-Small Cell Lung Carcinoma	Lung carcinoma	BEFREE	19211441, 24647424, 29234153, 30968155		★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	Pubtator	36297056	Associate	★☆☆☆☆ Found in Text Mining only
Oral cleft	Oral cleft	GWASCAT_DG	28054174		★☆☆☆☆ Found in Text Mining only
Orofacial Cleft 1	Orofacial cleft	Pubtator	28489749, 35191549	Associate	★★★☆☆ Reported in Unknown/Other Associations (≥2 sources)
Osteoarthritis	Osteoarthritis	Pubtator	19822088	Inhibit	★☆☆☆☆ Found in Text Mining only
Osteoglophonic dwarfism	Osteoglosphonic dysplasia	BEFREE	29321724		★☆☆☆☆ Found in Text Mining only
Otofaciocervical Syndrome	Otofaciocervical syndrome	Pubtator	35191549	Associate	★☆☆☆☆ Found in Text Mining only
ovarian neoplasm	Ovarian neoplasm	BEFREE	28475012		★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Ovarian neoplasm	Pubtator	21789787	Stimulate	★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Ovarian neoplasm	Pubtator	37337170	Associate	★☆☆☆☆ Found in Text Mining only
Pancreatic carcinoma	Pancreatic carcinoma	BEFREE	27034160		★☆☆☆☆ Found in Text Mining only
Pancreatic Ductal Adenocarcinoma	Pancreatic adenocarcinoma	BEFREE	27034160		★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasms	Pancreatic neoplasm	Pubtator	25001177	Associate	★☆☆☆☆ Found in Text Mining only
Parkinson Disease	Parkinson disease	Pubtator	36751943	Associate	★☆☆☆☆ Found in Text Mining only
Periodontal Diseases	Periodontal Diseases	BEFREE	31769036		★☆☆☆☆ Found in Text Mining only
Periodontitis	Periodontitis	BEFREE	31769036		★☆☆☆☆ Found in Text Mining only
Primary biliary cirrhosis	Biliary Cirrhosis	BEFREE	29297981		★☆☆☆☆ Found in Text Mining only
Prostate carcinoma	Prostate cancer	BEFREE	23666553, 27815019		★☆☆☆☆ Found in Text Mining only
Pulmonary Fibrosis	Pulmonary Fibrosis	BEFREE	26749424		★☆☆☆☆ Found in Text Mining only
Renal carcinoma	Renal Carcinoma	BEFREE	23526078		★☆☆☆☆ Found in Text Mining only
Renal Cell Carcinoma	Renal Carcinoma	BEFREE	23526078		★☆☆☆☆ Found in Text Mining only
Retinal Diseases	Retinal Diseases	BEFREE	21508652		★☆☆☆☆ Found in Text Mining only
Rheumatoid Arthritis	Rheumatoid arthritis	GWASDB_DG	19503088		★☆☆☆☆ Found in Text Mining only
Rheumatoid Arthritis	Rheumatoid arthritis	BEFREE	19822088		★☆☆☆☆ Found in Text Mining only
Senile Plaques	Senile Plaques	BEFREE	28501620		★☆☆☆☆ Found in Text Mining only
Sensorineural Hearing Loss (disorder)	Hearing Loss	BEFREE	28373074		★☆☆☆☆ Found in Text Mining only
Septicemia	Septicemia	BEFREE	31639817		★☆☆☆☆ Found in Text Mining only
Specific learning disability	Specific Learning Disorder	HPO_DG			★☆☆☆☆ Found in Text Mining only
Stomach Carcinoma	Stomach Carcinoma	BEFREE	29305865, 30106432, 31289590		★☆☆☆☆ Found in Text Mining only
Subarachnoid Hemorrhage	Subarachnoid hemorrhage	BEFREE	28347836, 28526701, 29162556, 30614619, 31047878		★☆☆☆☆ Found in Text Mining only
Subarachnoid Hemorrhage	Subarachnoid hemorrhage	CTD_human_DG	29162556		★☆☆☆☆ Found in Text Mining only
Thymoma	Thymoma	BEFREE	28251919, 28682959		★☆☆☆☆ Found in Text Mining only
Thyroid Dysgenesis	Thyroid Dysgenesis	BEFREE	25353184		★☆☆☆☆ Found in Text Mining only
Ulcerative Colitis	Ulcerative colitis	BEFREE	19721007		★☆☆☆☆ Found in Text Mining only
Urinary Bladder Neoplasms	Urinary bladder neoplasms	Pubtator	24528886, 32141538	Associate	★☆☆☆☆ Found in Text Mining only
Xanthomatosis	Xanthomatosis	Pubtator	40275124	Associate	★☆☆☆☆ Found in Text Mining only