CD86 (CD86 molecule)

Gene

• Entrez ID: 942
• Gene name: CD86 molecule
• Gene symbol: CD86
• Synonyms (NCBI Gene): B7-2, B7.2, B70, CD28LG2, LAB72
• Chromosome: 3
• Chromosome location: 3q13.33
• Summary: This gene encodes a type I membrane protein that is a member of the immunoglobulin superfamily. This protein is expressed by antigen-presenting cells, and it is the ligand for two proteins at the cell surface of T cells, CD28 antigen and cytotoxic T-lymph

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT021271	hsa-miR-146a-5p	Other	20375304
MIRT022558	hsa-miR-124-3p	Microarray	18668037
MIRT659681	hsa-miR-496	HITS-CLIP	23824327
MIRT659680	hsa-miR-3156-5p	HITS-CLIP	23824327
MIRT639533	hsa-miR-6817-3p	HITS-CLIP	23824327
MIRT639532	hsa-miR-130b-5p	HITS-CLIP	23824327
MIRT659678	hsa-miR-7114-5p	HITS-CLIP	23824327
MIRT659679	hsa-miR-376b-5p	HITS-CLIP	23824327
MIRT659677	hsa-miR-376c-5p	HITS-CLIP	23824327
MIRT659676	hsa-miR-3691-5p	HITS-CLIP	23824327
MIRT659675	hsa-miR-8056	HITS-CLIP	23824327
MIRT639531	hsa-miR-6873-3p	HITS-CLIP	23824327
MIRT639529	hsa-miR-4753-3p	HITS-CLIP	23824327
MIRT659674	hsa-miR-6869-5p	HITS-CLIP	23824327
MIRT659673	hsa-miR-4752	HITS-CLIP	23824327
MIRT639530	hsa-miR-4768-5p	HITS-CLIP	23824327
MIRT639528	hsa-miR-6833-3p	HITS-CLIP	23824327
MIRT639527	hsa-miR-6809-3p	HITS-CLIP	23824327
MIRT659672	hsa-miR-8081	HITS-CLIP	23824327
MIRT659671	hsa-miR-8055	HITS-CLIP	23824327
MIRT639534	hsa-miR-7110-3p	HITS-CLIP	23824327
MIRT639533	hsa-miR-6817-3p	HITS-CLIP	23824327
MIRT639532	hsa-miR-130b-5p	HITS-CLIP	23824327
MIRT639531	hsa-miR-6873-3p	HITS-CLIP	23824327
MIRT639529	hsa-miR-4753-3p	HITS-CLIP	23824327
MIRT639530	hsa-miR-4768-5p	HITS-CLIP	23824327
MIRT639528	hsa-miR-6833-3p	HITS-CLIP	23824327
MIRT639527	hsa-miR-6809-3p	HITS-CLIP	23824327
MIRT732964	hsa-miR-200a-3p	qRT-PCR	33788641
MIRT736409	hsa-miR-491-3p	qRT-PCR, Flow cytometry	33679688
MIRT659681	hsa-miR-496	HITS-CLIP	23824327
MIRT659680	hsa-miR-3156-5p	HITS-CLIP	23824327
MIRT639533	hsa-miR-6817-3p	HITS-CLIP	23824327
MIRT639532	hsa-miR-130b-5p	HITS-CLIP	23824327
MIRT659678	hsa-miR-7114-5p	HITS-CLIP	23824327
MIRT659679	hsa-miR-376b-5p	HITS-CLIP	23824327
MIRT659677	hsa-miR-376c-5p	HITS-CLIP	23824327
MIRT659676	hsa-miR-3691-5p	HITS-CLIP	23824327
MIRT659675	hsa-miR-8056	HITS-CLIP	23824327
MIRT639531	hsa-miR-6873-3p	HITS-CLIP	23824327
MIRT639529	hsa-miR-4753-3p	HITS-CLIP	23824327
MIRT659674	hsa-miR-6869-5p	HITS-CLIP	23824327
MIRT659673	hsa-miR-4752	HITS-CLIP	23824327
MIRT639530	hsa-miR-4768-5p	HITS-CLIP	23824327
MIRT639528	hsa-miR-6833-3p	HITS-CLIP	23824327
MIRT639527	hsa-miR-6809-3p	HITS-CLIP	23824327
MIRT659672	hsa-miR-8081	HITS-CLIP	23824327
MIRT659671	hsa-miR-8055	HITS-CLIP	23824327
MIRT639534	hsa-miR-7110-3p	HITS-CLIP	23824327
MIRT639533	hsa-miR-6817-3p	HITS-CLIP	23824327
MIRT639532	hsa-miR-130b-5p	HITS-CLIP	23824327
MIRT639531	hsa-miR-6873-3p	HITS-CLIP	23824327
MIRT639529	hsa-miR-4753-3p	HITS-CLIP	23824327
MIRT639530	hsa-miR-4768-5p	HITS-CLIP	23824327
MIRT639528	hsa-miR-6833-3p	HITS-CLIP	23824327
MIRT639527	hsa-miR-6809-3p	HITS-CLIP	23824327
MIRT876374	hsa-miR-3194-5p	CLIP-seq
MIRT876375	hsa-miR-4640-5p	CLIP-seq
MIRT876376	hsa-miR-4690-3p	CLIP-seq
MIRT876377	hsa-miR-4726-5p	CLIP-seq
MIRT876378	hsa-miR-662	CLIP-seq
MIRT876379	hsa-miR-1236	CLIP-seq
MIRT876380	hsa-miR-1301	CLIP-seq
MIRT876381	hsa-miR-202	CLIP-seq
MIRT876382	hsa-miR-3123	CLIP-seq
MIRT876383	hsa-miR-3157-5p	CLIP-seq
MIRT876384	hsa-miR-3183	CLIP-seq
MIRT876385	hsa-miR-4520a-3p	CLIP-seq
MIRT876386	hsa-miR-4520b-3p	CLIP-seq
MIRT876387	hsa-miR-4529-3p	CLIP-seq
MIRT876388	hsa-miR-4660	CLIP-seq
MIRT876389	hsa-miR-4678	CLIP-seq
MIRT876390	hsa-miR-4691-3p	CLIP-seq
MIRT876391	hsa-miR-4723-3p	CLIP-seq
MIRT876392	hsa-miR-5047	CLIP-seq
MIRT876393	hsa-miR-516b	CLIP-seq
MIRT876394	hsa-miR-665	CLIP-seq
MIRT876395	hsa-miR-765	CLIP-seq
MIRT2196775	hsa-miR-4461	CLIP-seq
MIRT2385805	hsa-miR-125a-5p	CLIP-seq
MIRT2385806	hsa-miR-125b	CLIP-seq
MIRT2385807	hsa-miR-4319	CLIP-seq
MIRT2385808	hsa-miR-4732-3p	CLIP-seq
MIRT2385809	hsa-miR-4733-3p	CLIP-seq
MIRT2385810	hsa-miR-4738-3p	CLIP-seq
MIRT2385811	hsa-miR-670	CLIP-seq

Transcription factors

Transcription factor	Regulation	Reference
NFKB1	Activation	15895390;15949284;18929846;19164127
NFKB1	Unknown	10586028
RELA	Activation	15895390;15949284;18929846;19164127
RELA	Unknown	10586028
STAT1	Unknown	10773351
TRERF1	Repression	18652845

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001618	Function	Virus receptor activity	IEA
GO:0002250	Process	Adaptive immune response	IEA
GO:0002376	Process	Immune system process	IEA
GO:0002639	Process	Positive regulation of immunoglobulin production	ISS
GO:0005515	Function	Protein binding	IPI	9915850, 11279501, 21982860, 25241761, 27708164
GO:0005886	Component	Plasma membrane	IC	10606960
GO:0005886	Component	Plasma membrane	IDA
GO:0005886	Component	Plasma membrane	IEA
GO:0005886	Component	Plasma membrane	NAS	7513726
GO:0005886	Component	Plasma membrane	TAS
GO:0006955	Process	Immune response	IBA
GO:0006955	Process	Immune response	TAS	7694363
GO:0007165	Process	Signal transduction	IEA
GO:0007166	Process	Cell surface receptor signaling pathway	IBA
GO:0008284	Process	Positive regulation of cell population proliferation	IEA
GO:0008284	Process	Positive regulation of cell population proliferation	TAS	7513726
GO:0009897	Component	External side of plasma membrane	IBA
GO:0009986	Component	Cell surface	HDA	23981064
GO:0015026	Function	Coreceptor activity	NAS	9915850
GO:0016020	Component	Membrane	IEA
GO:0031295	Process	T cell costimulation	IBA
GO:0031295	Process	T cell costimulation	IDA	8484124
GO:0032743	Process	Positive regulation of interleukin-2 production	NAS	9915850
GO:0032753	Process	Positive regulation of interleukin-4 production	NAS	9915850
GO:0032761	Process	Positive regulation of lymphotoxin A production	NAS	9915850
GO:0034451	Component	Centriolar satellite	IDA
GO:0038023	Function	Signaling receptor activity	TAS	7694363
GO:0042102	Process	Positive regulation of T cell proliferation	IBA
GO:0042110	Process	T cell activation	IDA	7568038, 7737275, 23918985
GO:0042110	Process	T cell activation	IDA	7527824
GO:0042113	Process	B cell activation	ISS
GO:0042130	Process	Negative regulation of T cell proliferation	IBA
GO:0045630	Process	Positive regulation of T-helper 2 cell differentiation	NAS	9915850
GO:0045893	Process	Positive regulation of DNA-templated transcription	NAS	9915850
GO:0046649	Process	Lymphocyte activation	IEA
GO:0046718	Process	Symbiont entry into host cell	IEA
GO:0048018	Function	Receptor ligand activity	IDA	24845157
GO:0070062	Component	Extracellular exosome	HDA	20458337
GO:0070062	Component	Extracellular exosome	IDA	15908444
GO:0071222	Process	Cellular response to lipopolysaccharide	IBA
GO:1901224	Process	Positive regulation of non-canonical NF-kappaB signal transduction	ISS

Other IDs

• MIM: 601020
• HGNC: 1705
• e!Ensembl: ENSG00000114013

Protein

• UniProt ID: P42081
• Protein name: T-lymphocyte activation antigen CD86 (Activation B7-2 antigen) (B70) (BU63) (CTLA-4 counter-receptor B7.2) (FUN-1) (CD antigen CD86)
• Protein function: Receptor involved in the costimulatory signal essential for T-lymphocyte proliferation and interleukin-2 production, by binding CD28 or CTLA-4 (PubMed:12196291). May play a critical role in the early events of T-cell activation and costimulation
• PDB: 1I85, 1NCN, 5YXK, 8FXX, 8FXY, 8HXB, 8HXC
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF07686	V-set	24 → 132	Immunoglobulin V-set domain	Domain
  PF13895	Ig_2	138 → 236	Immunoglobulin domain	Domain

• Tissue specificity: TISSUE SPECIFICITY: Expressed by activated B-lymphocytes and monocytes.
• Sequence:

  MDPQCTMGLSNILFVMAFLLSGAAPLKIQAYFNETADLPCQFANSQNQSLSELVVFWQDQ
  ENLVLNEVYLGKEKFDSVHSKYMGRTSFDSDSWTLRLHNLQIKDKGLYQCIIHHKKPTGM
  IRIHQMNSELSVLANFSQPEIVPISNITENVYINLTCSSIHGYPEPKKMSVLLRTKNSTI
  EYDGVMQKSQDNVTELYDVSISLSVSFPDVTSNMTIFCILETDKTRLLSSPFSIELEDPQ
  PPPDHIPWITAVLPTVIICVMVFCLILWKWKKKKRPRNSYKCGTNTMEREESEQTKKREK
  IHIPERSDEAQRVFKSSKTSSCDKSDTCF

• Sequence length: 329

Pathways

KEGG:

Virion - Adenovirus
Cell adhesion molecules
Toll-like receptor signaling pathway
Intestinal immune network for IgA production
Type I diabetes mellitus
Kaposi sarcoma-associated herpesvirus infection
Transcriptional misregulation in cancer
Autoimmune thyroid disease
Systemic lupus erythematosus
Rheumatoid arthritis
Allograft rejection
Graft-versus-host disease
Viral myocarditis

Reactome:

PIP3 activates AKT signaling
Constitutive Signaling by Aberrant PI3K in Cancer
CD28 co-stimulation
CD28 dependent PI3K/Akt signaling
CD28 dependent Vav1 pathway
CTLA4 inhibitory signaling
Interleukin-10 signaling
PI5P, PP2A and IER3 Regulate PI3K/AKT Signaling

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
ASTHMA	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
AUTOIMMUNE THYROID DISEASE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CHRONIC OBSTRUCTIVE AIRWAY DISEASE	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CONTACT DERMATITIS	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DEMENTIA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DERMATITIS, CONTACT	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DIABETES MELLITUS, INSULIN-DEPENDENT	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DIFFUSE LARGE B-CELL LYMPHOMA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
GASTRO-ENTEROPANCREATIC NEUROENDOCRINE TUMOR	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HENOCH-SCHOENLEIN PURPURA	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HODGKINS LYMPHOMA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LIVER CIRRHOSIS, EXPERIMENTAL	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LIVER DISEASES	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MULTIPLE MYELOMA	—	CTD, GWAS catalog CTD, GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MULTIPLE SCLEROSIS	—	Disgenet, GWAS catalog Disgenet, GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
NON-HODGKINS LYMPHOMA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SELECTIVE IGA DEFICIENCY DISEASE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SYSTEMIC LUPUS ERYTHEMATOSUS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SYSTEMIC SCLERODERMA	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Thyroid cancer, nonmedullary, 1	Uncertain significance	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Acute lymphocytic leukemia	Lymphocytic Leukemia	BEFREE	17101562, 21492747, 24283754, 27718302, 29530508		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma	Adenocarcinoma	BEFREE	31161312		★☆☆☆☆ Found in Text Mining only
Adenoma	Adenoma	BEFREE	29277562		★☆☆☆☆ Found in Text Mining only
Adrenoleukodystrophy	Adrenoleukodystrophy	Pubtator	29860501	Associate	★☆☆☆☆ Found in Text Mining only
Adult Acute Lymphocytic Leukemia	Lymphocytic Leukemia	BEFREE	21492747		★☆☆☆☆ Found in Text Mining only
Adult T-Cell Lymphoma/Leukemia	T-Cell Lymphoma/Leukemia	BEFREE	23750452		★☆☆☆☆ Found in Text Mining only
Allergic rhinitis (disorder)	Allergic rhinitis	BEFREE	30449135, 31485639		★☆☆☆☆ Found in Text Mining only
Alloimmunisation	Alloimmunisation	BEFREE	28769101		★☆☆☆☆ Found in Text Mining only
Alzheimer Disease	Alzheimer disease	Pubtator	19849713	Associate	★☆☆☆☆ Found in Text Mining only
Anemia Aplastic	Aplastic anemia	Pubtator	35579089	Associate	★☆☆☆☆ Found in Text Mining only
Anemia Aplastic	Aplastic anemia	Pubtator	36334505	Stimulate	★☆☆☆☆ Found in Text Mining only
Aortic Valve Stenosis	Aortic Valve Sclerosis	BEFREE	28097522, 29212122		★☆☆☆☆ Found in Text Mining only
Arthritis Infectious	Infective arthritis	Pubtator	21540807, 32849606	Associate	★☆☆☆☆ Found in Text Mining only
Arthritis Juvenile	Juvenile arthritis	Pubtator	32787920	Associate	★☆☆☆☆ Found in Text Mining only
Arthritis Psoriatic	Psoriatic arthritis	Pubtator	16507115	Associate	★☆☆☆☆ Found in Text Mining only
Arthritis Rheumatoid	Rheumatoid arthritis	Pubtator	11037875, 17328044	Stimulate	★☆☆☆☆ Found in Text Mining only
Arthritis Rheumatoid	Rheumatoid arthritis	Pubtator	12417058, 19384869, 19930661, 20398308, 20735866, 23661460, 26980135, 31338093, 32048307, 32228715	Associate	★☆☆☆☆ Found in Text Mining only
Arthritis, Psoriatic	Psoriatic Arthritis	BEFREE	16507115		★☆☆☆☆ Found in Text Mining only
Asthma	Asthma	LHGDN	15059478, 17513529		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Asthma	Asthma	Pubtator	15958078, 17513529, 19852851, 26368653	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Asthma	Asthma	BEFREE	17513529, 19852851		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Atherosclerosis	Atherosclerosis	LHGDN	18506362		★☆☆☆☆ Found in Text Mining only
Atherosclerosis	Atherosclerosis	Pubtator	26871397, 32787365, 32821283, 34925641	Associate	★☆☆☆☆ Found in Text Mining only
Autoimmune Diseases	Autoimmune Diseases	BEFREE	10201965, 10477593, 20380573, 21563968, 21715687, 21978690, 23661460, 28747139, 29039143, 30830871, 31448543		★☆☆☆☆ Found in Text Mining only
Autoimmune Diseases	Autoimmune disease	Pubtator	20398308, 23661460, 32996901, 33193306, 9824486	Associate	★☆☆☆☆ Found in Text Mining only
B-Cell Lymphomas	B-Cell Lymphoma	LHGDN	11726649		★☆☆☆☆ Found in Text Mining only
B-CELL MALIGNANCY, LOW-GRADE	Lymphocytic Leukemia	BEFREE	11986949		★☆☆☆☆ Found in Text Mining only
Behcet Syndrome	Behcet disease	Pubtator	36333776	Stimulate	★☆☆☆☆ Found in Text Mining only
Berylliosis	Berylliosis	Pubtator	25689051	Associate	★☆☆☆☆ Found in Text Mining only
beta Thalassemia	Beta thalassemia	Pubtator	28503568	Associate	★☆☆☆☆ Found in Text Mining only
Bladder Neoplasm	Bladder Neoplasm	BEFREE	10209504		★☆☆☆☆ Found in Text Mining only
Blister	Blister	Pubtator	26293297	Associate	★☆☆☆☆ Found in Text Mining only
Brachydactyly Type D	Brachydactyly	Pubtator	28504607	Stimulate	★☆☆☆☆ Found in Text Mining only
Brain Diseases	Brain disease	Pubtator	40510346	Associate	★☆☆☆☆ Found in Text Mining only
Brain Neoplasms	Brain neoplasms	Pubtator	40510346	Associate	★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	29129494		★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	37106127	Associate	★☆☆☆☆ Found in Text Mining only
Bruton type agammaglobulinemia	Bruton type agammaglobulinemia	Pubtator	30147693	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Basal Cell	Basal cell carcinoma	Pubtator	9033277	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	15965645, 21674477, 23150092, 26938527, 31810126, 32377744, 37406019	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Intraductal Noninfiltrating	Intraductal noninfiltrating carcinoma	Pubtator	26249178	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma of bladder	Bladder carcinoma	BEFREE	10209504		★☆☆☆☆ Found in Text Mining only
Carcinoma of lung	Lung carcinoma	BEFREE	29933059		★☆☆☆☆ Found in Text Mining only
Carcinoma Renal Cell	Renal cell carcinoma	Pubtator	10408703	Inhibit	★☆☆☆☆ Found in Text Mining only
Carcinoma Renal Cell	Renal cell carcinoma	Pubtator	10447932, 31950034, 36854280	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Squamous Cell	Squamous cell carcinoma	Pubtator	36922519	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Transitional Cell	Transitional cell carcinoma	Pubtator	10209504	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma, Ovarian Epithelial	Ovarian Epithelial carcinoma	BEFREE	14715418		★☆☆☆☆ Found in Text Mining only
Carcinomatosis of peritoneal cavity	Peritoneal Carcinomatosis	BEFREE	10606960		★☆☆☆☆ Found in Text Mining only
Cardiomyopathies	Cardiomyopathy	Pubtator	16584112, 8563121	Associate	★☆☆☆☆ Found in Text Mining only
Cardiovascular Diseases	Cardiovascular Diseases	BEFREE	20230296		★☆☆☆☆ Found in Text Mining only
Carotid Stenosis	Carotid artery stenosis	Pubtator	40239267	Associate	★☆☆☆☆ Found in Text Mining only
Celiac Disease	Celiac disease	BEFREE	12121279		★☆☆☆☆ Found in Text Mining only
Celiac Disease	Celiac disease	Pubtator	34576145	Associate	★☆☆☆☆ Found in Text Mining only
Cervical Intraepithelial Neoplasia	Cervical Intraepithelial Neoplasia	BEFREE	23521696		★☆☆☆☆ Found in Text Mining only
Childhood Acute Lymphoblastic Leukemia	Lymphoblastic Leukemia	BEFREE	21492747		★☆☆☆☆ Found in Text Mining only
Chronic Lymphocytic Leukemia	Lymphocytic Leukemia	BEFREE	11986949, 20520640, 23154584, 30406401		★☆☆☆☆ Found in Text Mining only
Chronic Obstructive Airway Disease	Chronic Obstructive Pulmonary Disease	BEFREE	20732370, 30137193		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Colitis Ulcerative	Ulcerative colitis	Pubtator	24347371	Inhibit	★☆☆☆☆ Found in Text Mining only
Colitis Ulcerative	Ulcerative colitis	Pubtator	32872480	Stimulate	★☆☆☆☆ Found in Text Mining only
Colitis Ulcerative	Ulcerative colitis	Pubtator	33793617	Associate	★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	18192692, 20380573, 20971123		★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	26759006, 34486997, 34964155, 39456247, 9640250	Associate	★☆☆☆☆ Found in Text Mining only
Common Variable Immunodeficiency	Common variable immunodeficiency	Pubtator	10760795, 12100033	Inhibit	★☆☆☆☆ Found in Text Mining only
Common Variable Immunodeficiency	Common Variable Immunodeficiency	BEFREE	12100033, 16424230		★☆☆☆☆ Found in Text Mining only
Common Variable Immunodeficiency	Common variable immunodeficiency	Pubtator	22454615	Associate	★☆☆☆☆ Found in Text Mining only
Complete atrioventricular block	Complete Atrioventricular Block	BEFREE	22892829		★☆☆☆☆ Found in Text Mining only
Contact Dermatitis	Dermatitis	CTD_human_DG	25724174		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Coronary Arteriosclerosis	Coronary Arteriosclerosis	BEFREE	20230296		★☆☆☆☆ Found in Text Mining only
Coronary Artery Disease	Coronary artery disease	LHGDN	17925605		★☆☆☆☆ Found in Text Mining only
Coronary Artery Disease	Coronary artery disease	BEFREE	20230296, 21297489		★☆☆☆☆ Found in Text Mining only
Coronary Artery Disease	Coronary artery disease	Pubtator	20628522	Stimulate	★☆☆☆☆ Found in Text Mining only
Coronary Disease	Coronary artery disease	Pubtator	19143751	Associate	★☆☆☆☆ Found in Text Mining only
Coronary heart disease	Coronary Heart Disease	BEFREE	20230296		★☆☆☆☆ Found in Text Mining only
Coronary Restenosis	Coronary restenosis	Pubtator	25253465	Stimulate	★☆☆☆☆ Found in Text Mining only
CREST Syndrome	CREST Syndrome	BEFREE	27992693		★☆☆☆☆ Found in Text Mining only
Crohn Disease	Crohn Disease	LHGDN	18069758		★☆☆☆☆ Found in Text Mining only
Crohn Disease	Crohn disease	Pubtator	18069758, 33924264	Associate	★☆☆☆☆ Found in Text Mining only
Crohn Disease	Crohn Disease	BEFREE	25072499		★☆☆☆☆ Found in Text Mining only
Degenerative polyarthritis	Arthritis	BEFREE	11037875, 19384869, 24911520, 30546406		★☆☆☆☆ Found in Text Mining only
Dermatitis Atopic	Atopic dermatitis	Pubtator	11028864, 37700026	Stimulate	★☆☆☆☆ Found in Text Mining only
Dermatitis Atopic 1	Atopic dermatitis	Pubtator	11028864	Associate	★☆☆☆☆ Found in Text Mining only
Dermatitis, Atopic	Dermatitis	BEFREE	29977237		★☆☆☆☆ Found in Text Mining only
Dermatologic disorders	Dermatologic Disorders	BEFREE	20954187		★☆☆☆☆ Found in Text Mining only
Diabetes	Diabetes	BEFREE	17947667, 29513874		★☆☆☆☆ Found in Text Mining only
Diabetes Gestational	Gestational diabetes	Pubtator	38029485	Associate	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes Mellitus	BEFREE	17947667, 29513874, 30522792		★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes mellitus	Pubtator	28454543	Stimulate	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes mellitus	Pubtator	29513874	Inhibit	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus Type 1	Diabetes mellitus, type 1	Pubtator	32483133	Stimulate	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus Type 1	Diabetes mellitus, type 1	Pubtator	33893332	Associate	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus Type 2	Diabetes mellitus, type 2	Pubtator	24378263	Stimulate	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Insulin-Dependent	Diabetes Mellitus	BEFREE	12724780, 25980680, 9725265		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Diabetes Mellitus, Non-Insulin-Dependent	Diabetes Mellitus	BEFREE	30356719		★☆☆☆☆ Found in Text Mining only
Diabetic Retinopathy	Diabetic retinopathy	Pubtator	37773794	Associate	★☆☆☆☆ Found in Text Mining only
Diffuse Large B-Cell Lymphoma	Diffuse Lymphoma	GWASCAT_DG	25261932		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Diffuse Large B-Cell Lymphoma	Diffuse Lymphoma	BEFREE	31600786		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Eczema	Eczema	BEFREE	29977237		★☆☆☆☆ Found in Text Mining only
Endometrial Neoplasms	Endometrial neoplasm	Pubtator	36199963, 37106127	Associate	★☆☆☆☆ Found in Text Mining only
Endometrial Neoplasms	Endometrial neoplasm	Pubtator	39387602	Inhibit	★☆☆☆☆ Found in Text Mining only
Endometriosis	Endometriosis	BEFREE	30276219		★☆☆☆☆ Found in Text Mining only
Endometriosis	Endometriosis	Pubtator	30276219	Inhibit	★☆☆☆☆ Found in Text Mining only
Eosinophilia	Eosinophilia	BEFREE	11290768		★☆☆☆☆ Found in Text Mining only
Eosinophilia	Eosinophilia	Pubtator	26047816	Associate	★☆☆☆☆ Found in Text Mining only
Epidermodysplasia Verruciformis	Epidermodysplasia verruciformis	Pubtator	35202881	Associate	★☆☆☆☆ Found in Text Mining only
Esophageal Neoplasms	Esophageal neoplasm	Pubtator	15052669	Associate	★☆☆☆☆ Found in Text Mining only
Ewings sarcoma	Ewing sarcoma	BEFREE	21870962		★☆☆☆☆ Found in Text Mining only
Gastro-enteropancreatic neuroendocrine tumor	Digestive system neuroendocrine neoplasm	CTD_human_DG	29915428		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Gastrointestinal Neoplasms	Gastrointestinal neoplasm	Pubtator	29999557, 33788641	Associate	★☆☆☆☆ Found in Text Mining only
Gastrointestinal Stromal Tumors	Gastrointestinal stromal tumor	Pubtator	32792357	Associate	★☆☆☆☆ Found in Text Mining only
Giant Cell Arteritis	Giant cell arteritis	Pubtator	31379838	Associate	★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	BEFREE	28338245, 29062041		★☆☆☆☆ Found in Text Mining only
Glioblastoma Multiforme	Glioblastoma	BEFREE	28338245, 29062041		★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	BEFREE	11950413, 14603470		★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	Pubtator	19688792	Associate	★☆☆☆☆ Found in Text Mining only
Glomerulonephritis IGA	Iga nephropathy	Pubtator	14871408	Associate	★☆☆☆☆ Found in Text Mining only
Glomerulonephritis IGA	Iga nephropathy	Pubtator	24219615	Stimulate	★☆☆☆☆ Found in Text Mining only
Graft-vs-Host Disease	Graft-Vs-Host Disease	LHGDN	18580477		★☆☆☆☆ Found in Text Mining only
Granulomatosis with Polyangiitis	Granulomatosis with polyangiitis	Pubtator	11737598, 9764612	Associate	★☆☆☆☆ Found in Text Mining only
Graves Disease	Graves Disease	BEFREE	16220002, 31755324		★☆☆☆☆ Found in Text Mining only
Hamartoma Syndrome, Multiple	Hamartoma	BEFREE	18069758		★☆☆☆☆ Found in Text Mining only
Hashimoto Disease	Hashimoto Disease	BEFREE	31755324		★☆☆☆☆ Found in Text Mining only
Hemophilia A	Hemophilia a	Pubtator	31194850	Associate	★☆☆☆☆ Found in Text Mining only
Hepatitis Autoimmune	Autoimmune hepatitis	Pubtator	16688797	Inhibit	★☆☆☆☆ Found in Text Mining only
Hepatitis C	Hepatitis c	Pubtator	28067225	Associate	★☆☆☆☆ Found in Text Mining only
Histiocytosis, Langerhans-Cell	Histiocytosis	BEFREE	27597420		★☆☆☆☆ Found in Text Mining only
Hodgkin Disease	Hodgkin Disease	BEFREE	10089910		★☆☆☆☆ Found in Text Mining only
Hodgkin Disease	Hodgkin disease	Pubtator	10971392, 20519630	Associate	★☆☆☆☆ Found in Text Mining only
Huntington Disease	Huntington disease	Pubtator	30346851	Inhibit	★☆☆☆☆ Found in Text Mining only
Hypereosinophilic Syndrome	Hypereosinophilic syndrome	Pubtator	10449520	Associate	★☆☆☆☆ Found in Text Mining only
Hyperglycemia	Hyperglycemia	BEFREE	30972941, 31674663		★☆☆☆☆ Found in Text Mining only
Hypertension Portal	Portal hypertension	Pubtator	34930041	Stimulate	★☆☆☆☆ Found in Text Mining only
Hypertensive disease	Hypertension	BEFREE	31253642		★☆☆☆☆ Found in Text Mining only
Hypoxia	Hypoxia	Pubtator	34456926	Inhibit	★☆☆☆☆ Found in Text Mining only
Idiopathic Inflammatory Myopathies	Inflammatory Myopathy	BEFREE	22964787		★☆☆☆☆ Found in Text Mining only
Idiopathic Pulmonary Fibrosis	Idiopathic pulmonary fibrosis	Pubtator	10678620	Associate	★☆☆☆☆ Found in Text Mining only
Idiopathic Pulmonary Fibrosis	Idiopathic pulmonary fibrosis	Pubtator	33925174	Stimulate	★☆☆☆☆ Found in Text Mining only
IGA Glomerulonephritis	Glomerulonephritis	BEFREE	14871408		★☆☆☆☆ Found in Text Mining only
IGA Glomerulonephritis	Glomerulonephritis	LHGDN	14871408		★☆☆☆☆ Found in Text Mining only
Immune System Diseases	Immune system disease	Pubtator	15730400	Associate	★☆☆☆☆ Found in Text Mining only
Immune thrombocytopenic purpura	Immune Thrombocytopenic Purpura	BEFREE	24897540, 28142207, 28946811, 30346851		★☆☆☆☆ Found in Text Mining only
Immunoglobulin A deficiency (disorder)	Immunoglobulin A deficiency	GWASCAT_DG	27723758		★☆☆☆☆ Found in Text Mining only
Inflammatory Bowel Diseases	Inflammatory bowel disease	Pubtator	15762887, 37918715, 9353156	Associate	★☆☆☆☆ Found in Text Mining only
Inflammatory Bowel Diseases	Inflammatory Bowel Disease	BEFREE	29774025		★☆☆☆☆ Found in Text Mining only
Kaposi Sarcoma	Kaposi Sarcoma	BEFREE	10370381		★☆☆☆☆ Found in Text Mining only
Kaposi Sarcoma	Kaposi Sarcoma	LHGDN	15280476		★☆☆☆☆ Found in Text Mining only
Kidney Diseases	Kidney disease	Pubtator	14871408, 21525579	Associate	★☆☆☆☆ Found in Text Mining only
Kidney Diseases	Kidney disease	Pubtator	17868260	Stimulate	★☆☆☆☆ Found in Text Mining only
Kidney Failure Chronic	Kidney failure	Pubtator	11260399	Inhibit	★☆☆☆☆ Found in Text Mining only
Leprosy	Leprosy	Pubtator	23283468	Associate	★☆☆☆☆ Found in Text Mining only
Leprosy	Leprosy	Pubtator	30389463	Stimulate	★☆☆☆☆ Found in Text Mining only
Leprosy Lepromatous	Leprosy	Pubtator	23283468	Inhibit	★☆☆☆☆ Found in Text Mining only
leukemia	Leukemia	BEFREE	11986949		★☆☆☆☆ Found in Text Mining only
Leukemia	Leukemia	Pubtator	15699173	Stimulate	★☆☆☆☆ Found in Text Mining only
Leukemia	Leukemia	Pubtator	27708227, 27718302, 40362518	Associate	★☆☆☆☆ Found in Text Mining only
Leukemia Myeloid	Myeloid leukemia	Pubtator	23175469	Associate	★☆☆☆☆ Found in Text Mining only
Leukemia Myeloid Acute	Myeloid leukemia	Pubtator	10706072, 11823047, 14662338, 15098140, 23175469, 25795133, 29720577, 30500073, 35642341, 9485189	Associate	★☆☆☆☆ Found in Text Mining only
Leukemia Myelomonocytic Chronic	Myelomonocytic leukemia	Pubtator	10554809	Associate	★☆☆☆☆ Found in Text Mining only
Leukemia, Myelocytic, Acute	Leukemia	BEFREE	11090069, 11342441, 11986949, 12580958, 18208411, 21520003, 27388616, 9485189		★☆☆☆☆ Found in Text Mining only
Leukemia, Myelocytic, Acute	Leukemia	LHGDN	16115907		★☆☆☆☆ Found in Text Mining only
Leukemia, T-Cell	T-cell leukemia	BEFREE	23750452		★☆☆☆☆ Found in Text Mining only
Lip and Oral Cavity Carcinoma	Lip and Oral Cavity Carcinoma	BEFREE	28454394		★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	26938527, 30062618, 31376622		★☆☆☆☆ Found in Text Mining only
Liver Cirrhosis Biliary	Liver cirrhosis	Pubtator	26388238	Associate	★☆☆☆☆ Found in Text Mining only
Liver Failure Acute	Liver failure	Pubtator	22837127	Associate	★☆☆☆☆ Found in Text Mining only
Liver Failure, Acute	Liver failure	BEFREE	22837127		★☆☆☆☆ Found in Text Mining only
Lung Diseases	Lung disease	Pubtator	37480005	Associate	★☆☆☆☆ Found in Text Mining only
Lung Diseases Interstitial	Lung disease	Pubtator	32996901	Associate	★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus Systemic	Systemic lupus erythematosus	Pubtator	10023862, 21250838, 22110167, 32576231, 33777025, 36180106, 36563528	Associate	★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus Systemic	Systemic lupus erythematosus	Pubtator	10323442, 11302879, 16879242, 17868260, 18958888, 20067533, 20478074, 29058308, 37700026	Stimulate	★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus Systemic	Systemic lupus erythematosus	Pubtator	17083624	Inhibit	★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus, Systemic	Lupus Erythematosus	BEFREE	11196673, 28338767, 28463775, 28778438, 30944545		★☆☆☆☆ Found in Text Mining only
Lupus Nephritis	Lupus Nephritis	BEFREE	30928350		★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic metastasis	Pubtator	25992611	Associate	★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic metastasis	Pubtator	26938527	Inhibit	★☆☆☆☆ Found in Text Mining only
Lymphoma Follicular	Lymphoma	Pubtator	9373240	Associate	★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	29129494		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of lung	Lung Cancer	BEFREE	29933059, 30153900		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of mouth	Malignant neoplasm of mouth	BEFREE	28454394		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of ovary	Ovarian cancer	BEFREE	14715418		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of pancreas	Pancreatic cancer	BEFREE	22821131, 26423423		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of urinary bladder	Urinary bladder cancer	BEFREE	10209504		★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	10477593, 21870962, 25369324, 28454394, 28716895, 30829675, 31628526		★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	BEFREE	23649001		★☆☆☆☆ Found in Text Mining only
Marinesco-Sjogren syndrome	Marinesco-Sjogren Syndrome	BEFREE	29155997		★☆☆☆☆ Found in Text Mining only
Mature B-Cell Neoplasm	B-Cell Neoplasm	GWASCAT_DG	25279986		★☆☆☆☆ Found in Text Mining only
melanoma	Melanoma	BEFREE	11950413, 26485753, 28424693, 29933059, 31161312		★☆☆☆☆ Found in Text Mining only
melanoma	Melanoma	LHGDN	14727087		★☆☆☆☆ Found in Text Mining only
Melanoma	Melanoma	Pubtator	14727087, 24778320	Inhibit	★☆☆☆☆ Found in Text Mining only
Melanoma	Melanoma	Pubtator	18221542, 21903207, 37614091, 9652756	Associate	★☆☆☆☆ Found in Text Mining only
Melanoma	Melanoma	Pubtator	36610941	Stimulate	★☆☆☆☆ Found in Text Mining only
Miscarriage	Miscarriage	BEFREE	21481059		★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Multiple myeloma	BEFREE	10029575, 24782505, 29296880, 31449833		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Multiple Myeloma	Multiple myeloma	Pubtator	10029575, 10942368, 26287276, 35380688, 36796620, 39493694	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Multiple Myeloma	Multiple myeloma	CTD_human_DG	16611307		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Multiple Sclerosis	Multiple sclerosis	Pubtator	11985531, 31181776	Stimulate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Multiple Sclerosis	Multiple sclerosis	Pubtator	15544628, 19666086, 20526818, 24472094, 25480859, 29361022, 33766068, 35000467, 7500044, 9169496	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Multiple Sclerosis	Multiple Sclerosis	GWASCAT_DG	21833088		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Multiple Sclerosis	Multiple Sclerosis	GWASDB_DG	21833088		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Multiple Sclerosis	Multiple Sclerosis	BEFREE	26531698, 28079472, 29361022		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Myasthenia Gravis	Myasthenia Gravis	BEFREE	12707978		★☆☆☆☆ Found in Text Mining only
Myelodysplastic Syndromes	Myelodysplastic syndrome	Pubtator	23714180, 32179638	Inhibit	★☆☆☆☆ Found in Text Mining only
Myelodysplastic Syndromes	Myelodysplastic syndrome	Pubtator	27565576	Associate	★☆☆☆☆ Found in Text Mining only
Myeloid Leukemia, Chronic	Myeloid Leukemia	BEFREE	12145689, 28074067, 30166420		★☆☆☆☆ Found in Text Mining only
Nasal Polyps	Nasal polyp	Pubtator	36466903	Associate	★☆☆☆☆ Found in Text Mining only
Nasopharyngeal carcinoma	Nasopharyngeal Carcinoma	BEFREE	17524139		★☆☆☆☆ Found in Text Mining only
Nasopharyngeal Carcinoma	Nasopharyngeal carcinoma	Pubtator	17524139	Associate	★☆☆☆☆ Found in Text Mining only
Necrosis	Necrosis	Pubtator	12905492	Inhibit	★☆☆☆☆ Found in Text Mining only
Necrosis	Necrosis	Pubtator	16108813	Stimulate	★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	10370381, 10702399, 10928114, 14502231, 14715418, 16517754, 17453965, 17768418, 18813779, 21740748, 21903207, 22305004, 24349559, 25374234, 26249178, 26423423, 26836118, 27108386, 28291636, 28454394, 28782555, 29212947, 29487385, 30017877, 30062618, 30123257		★☆☆☆☆ Found in Text Mining only
Nephritis	Nephritis	BEFREE	31017008		★☆☆☆☆ Found in Text Mining only
Nephritis Interstitial	Interstitial nephritis	Pubtator	11302869	Associate	★☆☆☆☆ Found in Text Mining only
Nephrotic Syndrome	Nephrotic syndrome	Pubtator	31352232	Associate	★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	Pubtator	12771917	Associate	★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	BEFREE	20718755		★☆☆☆☆ Found in Text Mining only
Neuropathy	Neuropathy	BEFREE	10908195		★☆☆☆☆ Found in Text Mining only
Non-Small Cell Lung Carcinoma	Lung carcinoma	BEFREE	11551413		★☆☆☆☆ Found in Text Mining only
Noninfiltrating Intraductal Carcinoma	Ductal carcinoma	BEFREE	26249178		★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	Pubtator	28454543, 32188105	Associate	★☆☆☆☆ Found in Text Mining only
Osteosarcoma	Osteosarcoma	BEFREE	21563968, 31440272		★☆☆☆☆ Found in Text Mining only
Ovarian Carcinoma	Ovarian Carcinoma	BEFREE	14715418		★☆☆☆☆ Found in Text Mining only
Ovarian Diseases	Ovarian diseases	Pubtator	10606960	Associate	★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Ovarian neoplasm	Pubtator	14715418	Associate	★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Ovarian neoplasm	Pubtator	28589429	Stimulate	★☆☆☆☆ Found in Text Mining only
Pancreatic carcinoma	Pancreatic carcinoma	BEFREE	22821131, 26423423		★☆☆☆☆ Found in Text Mining only
Paraparesis Tropical Spastic	Tropical spastic paraparesis	Pubtator	10225829	Associate	★☆☆☆☆ Found in Text Mining only
Paraparesis Tropical Spastic	Tropical spastic paraparesis	Pubtator	23750452, 24472094	Stimulate	★☆☆☆☆ Found in Text Mining only
Pemphigus	Pemphigus	BEFREE	28274366		★☆☆☆☆ Found in Text Mining only
Pemphigus Foliaceus	Pemphigus Foliaceus	BEFREE	20433886, 28274366		★☆☆☆☆ Found in Text Mining only
Pemphigus Vulgaris	Pemphigus Vulgaris	BEFREE	28274366, 31342641		★☆☆☆☆ Found in Text Mining only
Peripheral Nervous System Diseases	Peripheral nervous system disease	Pubtator	10945811	Associate	★☆☆☆☆ Found in Text Mining only
Peripheral Nervous System Diseases	Nervous System Diseases	BEFREE	31415574		★☆☆☆☆ Found in Text Mining only
Peripheral Neuropathy	Peripheral Neuropathy	BEFREE	31415574		★☆☆☆☆ Found in Text Mining only
Peripheral T-Cell Lymphoma	T-Cell Lymphoma	BEFREE	26719098		★☆☆☆☆ Found in Text Mining only
Peritoneal Neoplasms	Peritoneal neoplasm	Pubtator	10606960	Associate	★☆☆☆☆ Found in Text Mining only
Pituitary Neoplasms	Pituitary neoplasm	Pubtator	32652004, 34745002	Associate	★☆☆☆☆ Found in Text Mining only
Polycythemia Vera	Polycythemia vera	Pubtator	36175590	Inhibit	★☆☆☆☆ Found in Text Mining only
Polymyositis	Polymyositis	BEFREE	12409186		★☆☆☆☆ Found in Text Mining only
Pre B-cell acute lymphoblastic leukemia	B-cell Lymphoma	BEFREE	26444983		★☆☆☆☆ Found in Text Mining only
Precursor B-cell lymphoblastic leukemia	Lymphoblastic Leukemia	BEFREE	26444983		★☆☆☆☆ Found in Text Mining only
Precursor Cell Lymphoblastic Leukemia Lymphoma	Lymphoblastic Leukemia	BEFREE	24283754, 27718302, 29530508		★☆☆☆☆ Found in Text Mining only
Primary biliary cirrhosis	Biliary Cirrhosis	BEFREE	29312539, 31027870		★☆☆☆☆ Found in Text Mining only
Psoriasis	Psoriasis	BEFREE	29395574		★☆☆☆☆ Found in Text Mining only
Psoriasis	Psoriasis	Pubtator	37700026	Stimulate	★☆☆☆☆ Found in Text Mining only
Pulmonary Arterial Hypertension	Pulmonary arterial hypertension	Pubtator	33604393	Associate	★☆☆☆☆ Found in Text Mining only
Pulmonary Disease Chronic Obstructive	Chronic obstructive pulmonary disease	Pubtator	16907910	Inhibit	★☆☆☆☆ Found in Text Mining only
Pulmonary Disease Chronic Obstructive	Chronic obstructive pulmonary disease	Pubtator	25775429, 26191210	Stimulate	★☆☆☆☆ Found in Text Mining only
Pulmonary Disease Chronic Obstructive	Chronic obstructive pulmonary disease	Pubtator	36051533	Associate	★☆☆☆☆ Found in Text Mining only
Rectal polyp	Rectal Polyp	BEFREE	29277562		★☆☆☆☆ Found in Text Mining only
Recurrent aphthous ulcer	Aphthous Ulcer	BEFREE	25482673		★☆☆☆☆ Found in Text Mining only
Respiratory Tract Infections	Respiratory system infectious disease	Pubtator	32996901	Associate	★☆☆☆☆ Found in Text Mining only
Rheumatic Chorea	Rheumatic Chorea	BEFREE	20080141		★☆☆☆☆ Found in Text Mining only
Rheumatoid Arthritis	Rheumatoid arthritis	BEFREE	11037875, 11196673, 23661460, 26246128, 30704942, 31338093		★☆☆☆☆ Found in Text Mining only
Rhinitis Allergic Seasonal	Seasonal allergic rhinitis	Pubtator	17359392	Stimulate	★☆☆☆☆ Found in Text Mining only
Sarcoidosis	Sarcoidosis	BEFREE	15942292		★☆☆☆☆ Found in Text Mining only
Sarcoidosis	Sarcoidosis	Pubtator	17626112, 21653741, 7586698	Associate	★☆☆☆☆ Found in Text Mining only
Scleroderma Systemic	Systemic sclerosis	Pubtator	14729510, 15188368	Stimulate	★☆☆☆☆ Found in Text Mining only
Selective immunoglobulin A deficiency	Selective Immunoglobulin A Deficiency	GWASCAT_DG	27723758		★☆☆☆☆ Found in Text Mining only
Sepsis	Sepsis	Pubtator	21540807	Associate	★☆☆☆☆ Found in Text Mining only
Sepsis	Sepsis	Pubtator	34566996	Inhibit	★☆☆☆☆ Found in Text Mining only
Septicemia	Septicemia	BEFREE	19672303, 23911358, 25129060, 25912130, 29891541, 30343689, 31651850		★☆☆☆☆ Found in Text Mining only
Sjogren's Syndrome	Sjogren syndrome	Pubtator	10025916	Stimulate	★☆☆☆☆ Found in Text Mining only
Sjogren's Syndrome	Sjogren syndrome	Pubtator	11302869	Associate	★☆☆☆☆ Found in Text Mining only
Skin Diseases	Skin disease	Pubtator	9033277	Associate	★☆☆☆☆ Found in Text Mining only
Squamous Cell Carcinoma of Head and Neck	Squamous cell carcinoma	Pubtator	28052009, 32281488, 32548602	Associate	★☆☆☆☆ Found in Text Mining only
Squamous Cell Carcinoma of Head and Neck	Squamous cell carcinoma	Pubtator	36983005	Stimulate	★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of tongue	Tongue carcinoma	BEFREE	31604589		★☆☆☆☆ Found in Text Mining only
ST segment elevation myocardial infarction	ST Segment Elevation Myocardial Infarction	BEFREE	21297489		★☆☆☆☆ Found in Text Mining only
Status Epilepticus	Status Epilepticus	BEFREE	24988410		★☆☆☆☆ Found in Text Mining only
Systemic Scleroderma	Scleroderma	BEFREE	16712644, 30053831		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TARSAL-CARPAL COALITION SYNDROME	Tarsal-Carpal Coalition Syndrome	BEFREE	10209504		★☆☆☆☆ Found in Text Mining only
Thrombocythemia Essential	Essential thrombocythemia	Pubtator	36175590	Inhibit	★☆☆☆☆ Found in Text Mining only
Thyroid associated opthalmopathies	Thyroid eye disease	BEFREE	20884055		★☆☆☆☆ Found in Text Mining only
Thyroid Neoplasm	Thyroid Neoplasm	LHGDN	12213904		★☆☆☆☆ Found in Text Mining only
Triglyceride storage disease with ichthyosis	Triglyceride Storage Disease With Ichthyosis	BEFREE	29075103		★☆☆☆☆ Found in Text Mining only
Triple Negative Breast Neoplasms	Triple negative breast cancer	Pubtator	32923150	Associate	★☆☆☆☆ Found in Text Mining only
Ulcerative Colitis	Ulcerative colitis	LHGDN	15628695		★☆☆☆☆ Found in Text Mining only
Ulcerative Colitis	Ulcerative colitis	BEFREE	24347371		★☆☆☆☆ Found in Text Mining only
Uremia	Uremia	Pubtator	11260399	Associate	★☆☆☆☆ Found in Text Mining only
Ureteral Neoplasms	Ureteral neoplasms	Pubtator	34862858	Stimulate	★☆☆☆☆ Found in Text Mining only
Urinary Bladder Neoplasms	Urinary bladder neoplasms	Pubtator	12875971	Associate	★☆☆☆☆ Found in Text Mining only
Uterine Cervical Dysplasia	Uterine disease	Pubtator	23521696	Inhibit	★☆☆☆☆ Found in Text Mining only