Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	9415
Gene name	Fatty acid desaturase 2
Gene symbol	FADS2
Synonyms (NCBI Gene)	D6DDES6FADSD6LLCDL2SLL0262TU13
Chromosome	11
Chromosome location	11q12.2
Summary	The protein encoded by this gene is a member of the fatty acid desaturase (FADS) gene family. Desaturase enzymes regulate unsaturation of fatty acids through the introduction of double bonds between defined carbons of the fatty acyl chain. FADS family mem

438

Show/Hide all (438)

miRTarBase ID	miRNA	Experiments	Reference
MIRT001634	hsa-let-7b-5p	pSILAC	18668040
MIRT017360	hsa-miR-335-5p	Microarray	18185580
MIRT029144	hsa-miR-26b-5p	Microarray	19088304
MIRT001634	hsa-let-7b-5p	Proteomics;Other	18668040
MIRT001634	hsa-let-7b-5p	CLASH	23622248
MIRT042871	hsa-miR-324-3p	CLASH	23622248
MIRT042511	hsa-miR-423-3p	CLASH	23622248
MIRT041155	hsa-miR-500a-3p	CLASH	23622248
MIRT040802	hsa-miR-18a-3p	CLASH	23622248
MIRT440695	hsa-miR-218-5p	HITS-CLIP	23212916
MIRT440695	hsa-miR-218-5p	HITS-CLIP	23212916
MIRT975057	hsa-miR-1204	CLIP-seq
MIRT975058	hsa-miR-125a-5p	CLIP-seq
MIRT975059	hsa-miR-125b	CLIP-seq
MIRT975060	hsa-miR-1291	CLIP-seq
MIRT975061	hsa-miR-1470	CLIP-seq
MIRT975062	hsa-miR-3150b-3p	CLIP-seq
MIRT975063	hsa-miR-3173-5p	CLIP-seq
MIRT975064	hsa-miR-3611	CLIP-seq
MIRT975065	hsa-miR-3614-5p	CLIP-seq
MIRT975066	hsa-miR-4252	CLIP-seq
MIRT975067	hsa-miR-4319	CLIP-seq
MIRT975068	hsa-miR-4428	CLIP-seq
MIRT975069	hsa-miR-4469	CLIP-seq
MIRT975070	hsa-miR-4667-3p	CLIP-seq
MIRT975071	hsa-miR-4701-5p	CLIP-seq
MIRT975072	hsa-miR-4709-3p	CLIP-seq
MIRT975073	hsa-miR-4732-3p	CLIP-seq
MIRT975074	hsa-miR-4784	CLIP-seq
MIRT975075	hsa-miR-576-3p	CLIP-seq
MIRT975076	hsa-miR-588	CLIP-seq
MIRT975077	hsa-miR-670	CLIP-seq
MIRT1548467	hsa-miR-3945	CLIP-seq
MIRT1548468	hsa-miR-4706	CLIP-seq
MIRT1548469	hsa-miR-4734	CLIP-seq
MIRT1548470	hsa-miR-4749-5p	CLIP-seq
MIRT1548471	hsa-miR-4787-5p	CLIP-seq
MIRT1548472	hsa-miR-744	CLIP-seq
MIRT1556333	hsa-miR-4728-5p	CLIP-seq
MIRT1548471	hsa-miR-4787-5p	CLIP-seq
MIRT975061	hsa-miR-1470	CLIP-seq
MIRT1988902	hsa-miR-3064-5p	CLIP-seq
MIRT1988903	hsa-miR-3175	CLIP-seq
MIRT1988904	hsa-miR-4492	CLIP-seq
MIRT1988905	hsa-miR-4498	CLIP-seq
MIRT975070	hsa-miR-4667-3p	CLIP-seq
MIRT1988906	hsa-miR-762	CLIP-seq
MIRT2223294	hsa-let-7a	CLIP-seq
MIRT2223295	hsa-let-7b	CLIP-seq
MIRT2223296	hsa-let-7c	CLIP-seq
MIRT2223297	hsa-let-7d	CLIP-seq
MIRT2223298	hsa-let-7e	CLIP-seq
MIRT2223299	hsa-let-7f	CLIP-seq
MIRT2223300	hsa-let-7g	CLIP-seq
MIRT2223301	hsa-let-7i	CLIP-seq
MIRT2223302	hsa-miR-101	CLIP-seq
MIRT2223303	hsa-miR-1197	CLIP-seq
MIRT975057	hsa-miR-1204	CLIP-seq
MIRT2223304	hsa-miR-1205	CLIP-seq
MIRT2223305	hsa-miR-1224-3p	CLIP-seq
MIRT2223306	hsa-miR-1245	CLIP-seq
MIRT975058	hsa-miR-125a-5p	CLIP-seq
MIRT975059	hsa-miR-125b	CLIP-seq
MIRT2223307	hsa-miR-1270	CLIP-seq
MIRT2223308	hsa-miR-1273f	CLIP-seq
MIRT2223309	hsa-miR-1286	CLIP-seq
MIRT2223310	hsa-miR-1298	CLIP-seq
MIRT2223311	hsa-miR-1324	CLIP-seq
MIRT2223312	hsa-miR-133a	CLIP-seq
MIRT2223313	hsa-miR-133b	CLIP-seq
MIRT2223314	hsa-miR-144	CLIP-seq
MIRT975061	hsa-miR-1470	CLIP-seq
MIRT2223315	hsa-miR-151-3p	CLIP-seq
MIRT2223316	hsa-miR-1587	CLIP-seq
MIRT2223317	hsa-miR-1827	CLIP-seq
MIRT2223318	hsa-miR-1915	CLIP-seq
MIRT2223319	hsa-miR-202	CLIP-seq
MIRT2223320	hsa-miR-219-5p	CLIP-seq
MIRT1988902	hsa-miR-3064-5p	CLIP-seq
MIRT2223321	hsa-miR-3065-3p	CLIP-seq
MIRT2223322	hsa-miR-3115	CLIP-seq
MIRT2223323	hsa-miR-3126-5p	CLIP-seq
MIRT2223324	hsa-miR-3127-5p	CLIP-seq
MIRT2223325	hsa-miR-3150a-3p	CLIP-seq
MIRT2223326	hsa-miR-3154	CLIP-seq
MIRT2223327	hsa-miR-3155	CLIP-seq
MIRT2223328	hsa-miR-3155b	CLIP-seq
MIRT975063	hsa-miR-3173-5p	CLIP-seq
MIRT1988903	hsa-miR-3175	CLIP-seq
MIRT2223329	hsa-miR-3179	CLIP-seq
MIRT2223330	hsa-miR-3183	CLIP-seq
MIRT2223331	hsa-miR-3185	CLIP-seq
MIRT2223332	hsa-miR-3189-3p	CLIP-seq
MIRT2223333	hsa-miR-3192	CLIP-seq
MIRT2223334	hsa-miR-3194-5p	CLIP-seq
MIRT2223335	hsa-miR-323-3p	CLIP-seq
MIRT2223336	hsa-miR-330-3p	CLIP-seq
MIRT2223337	hsa-miR-3612	CLIP-seq
MIRT975065	hsa-miR-3614-5p	CLIP-seq
MIRT2223338	hsa-miR-3620	CLIP-seq
MIRT2223339	hsa-miR-3652	CLIP-seq
MIRT2223340	hsa-miR-3660	CLIP-seq
MIRT2223341	hsa-miR-3664-3p	CLIP-seq
MIRT2223342	hsa-miR-3672	CLIP-seq
MIRT2223343	hsa-miR-3689a-3p	CLIP-seq
MIRT2223344	hsa-miR-3689c	CLIP-seq
MIRT2223345	hsa-miR-3690	CLIP-seq
MIRT2223346	hsa-miR-3714	CLIP-seq
MIRT2223347	hsa-miR-3918	CLIP-seq
MIRT2223348	hsa-miR-3922-5p	CLIP-seq
MIRT2223349	hsa-miR-3943	CLIP-seq
MIRT1548467	hsa-miR-3945	CLIP-seq
MIRT2223350	hsa-miR-3974	CLIP-seq
MIRT2223351	hsa-miR-4266	CLIP-seq
MIRT2223352	hsa-miR-4268	CLIP-seq
MIRT2223353	hsa-miR-4281	CLIP-seq
MIRT2223354	hsa-miR-4290	CLIP-seq
MIRT2223355	hsa-miR-4313	CLIP-seq
MIRT975067	hsa-miR-4319	CLIP-seq
MIRT2223356	hsa-miR-432	CLIP-seq
MIRT2223357	hsa-miR-4329	CLIP-seq
MIRT2223358	hsa-miR-4419a	CLIP-seq
MIRT2223359	hsa-miR-4430	CLIP-seq
MIRT2223360	hsa-miR-4434	CLIP-seq
MIRT2223361	hsa-miR-4435	CLIP-seq
MIRT2223362	hsa-miR-4436a	CLIP-seq
MIRT2223363	hsa-miR-4436b-3p	CLIP-seq
MIRT2223364	hsa-miR-4438	CLIP-seq
MIRT2223365	hsa-miR-4446-3p	CLIP-seq
MIRT2223366	hsa-miR-4448	CLIP-seq
MIRT2223367	hsa-miR-4457	CLIP-seq
MIRT2223368	hsa-miR-4458	CLIP-seq
MIRT2223369	hsa-miR-4459	CLIP-seq
MIRT2223370	hsa-miR-4463	CLIP-seq
MIRT2223371	hsa-miR-4464	CLIP-seq
MIRT975069	hsa-miR-4469	CLIP-seq
MIRT2223372	hsa-miR-4489	CLIP-seq
MIRT1988904	hsa-miR-4492	CLIP-seq
MIRT1988905	hsa-miR-4498	CLIP-seq
MIRT2223373	hsa-miR-4499	CLIP-seq
MIRT2223374	hsa-miR-4500	CLIP-seq
MIRT2223375	hsa-miR-4505	CLIP-seq
MIRT2223376	hsa-miR-4510	CLIP-seq
MIRT2223377	hsa-miR-4516	CLIP-seq
MIRT2223378	hsa-miR-4526	CLIP-seq
MIRT2223379	hsa-miR-4531	CLIP-seq
MIRT2223380	hsa-miR-4535	CLIP-seq
MIRT2223381	hsa-miR-4632	CLIP-seq
MIRT2223382	hsa-miR-4645-3p	CLIP-seq
MIRT2223383	hsa-miR-4656	CLIP-seq
MIRT2223384	hsa-miR-4660	CLIP-seq
MIRT2223385	hsa-miR-4661-3p	CLIP-seq
MIRT2223386	hsa-miR-4663	CLIP-seq
MIRT975070	hsa-miR-4667-3p	CLIP-seq
MIRT2223387	hsa-miR-4674	CLIP-seq
MIRT2223388	hsa-miR-4675	CLIP-seq
MIRT2223389	hsa-miR-4693-3p	CLIP-seq
MIRT2223390	hsa-miR-4695-5p	CLIP-seq
MIRT975071	hsa-miR-4701-5p	CLIP-seq
MIRT1548468	hsa-miR-4706	CLIP-seq
MIRT2223391	hsa-miR-4708-3p	CLIP-seq
MIRT2223392	hsa-miR-4721	CLIP-seq
MIRT2223393	hsa-miR-4722-5p	CLIP-seq
MIRT2223394	hsa-miR-4723-3p	CLIP-seq
MIRT2223395	hsa-miR-4726-3p	CLIP-seq
MIRT2223396	hsa-miR-4727-5p	CLIP-seq
MIRT1556333	hsa-miR-4728-5p	CLIP-seq
MIRT975073	hsa-miR-4732-3p	CLIP-seq
MIRT1548469	hsa-miR-4734	CLIP-seq
MIRT2223397	hsa-miR-4736	CLIP-seq
MIRT2223398	hsa-miR-4740-3p	CLIP-seq
MIRT2223399	hsa-miR-4741	CLIP-seq
MIRT2223400	hsa-miR-4748	CLIP-seq
MIRT2223401	hsa-miR-4749-3p	CLIP-seq
MIRT1548470	hsa-miR-4749-5p	CLIP-seq
MIRT2223402	hsa-miR-4753-5p	CLIP-seq
MIRT2223403	hsa-miR-4768-3p	CLIP-seq
MIRT2223404	hsa-miR-4772-3p	CLIP-seq
MIRT2223405	hsa-miR-4776-5p	CLIP-seq
MIRT2223406	hsa-miR-4779	CLIP-seq
MIRT2223407	hsa-miR-4782-3p	CLIP-seq
MIRT2223408	hsa-miR-4783-3p	CLIP-seq
MIRT1548471	hsa-miR-4787-5p	CLIP-seq
MIRT2223409	hsa-miR-484	CLIP-seq
MIRT2223410	hsa-miR-488	CLIP-seq
MIRT2223411	hsa-miR-492	CLIP-seq
MIRT2223412	hsa-miR-495	CLIP-seq
MIRT2223413	hsa-miR-513a-5p	CLIP-seq
MIRT2223414	hsa-miR-513b	CLIP-seq
MIRT2223415	hsa-miR-515-3p	CLIP-seq
MIRT2223416	hsa-miR-519e	CLIP-seq
MIRT2223417	hsa-miR-544b	CLIP-seq
MIRT2223418	hsa-miR-548an	CLIP-seq
MIRT2223419	hsa-miR-548b-3p	CLIP-seq
MIRT2223420	hsa-miR-558	CLIP-seq
MIRT975076	hsa-miR-588	CLIP-seq
MIRT2223421	hsa-miR-617	CLIP-seq
MIRT2223422	hsa-miR-620	CLIP-seq
MIRT2223423	hsa-miR-634	CLIP-seq
MIRT2223424	hsa-miR-642a	CLIP-seq
MIRT2223425	hsa-miR-646	CLIP-seq
MIRT2223426	hsa-miR-647	CLIP-seq
MIRT2223427	hsa-miR-650	CLIP-seq
MIRT2223428	hsa-miR-657	CLIP-seq
MIRT975077	hsa-miR-670	CLIP-seq
MIRT2223429	hsa-miR-7	CLIP-seq
MIRT1548472	hsa-miR-744	CLIP-seq
MIRT1988906	hsa-miR-762	CLIP-seq
MIRT2223430	hsa-miR-766	CLIP-seq
MIRT2223431	hsa-miR-767-3p	CLIP-seq
MIRT2223432	hsa-miR-769-5p	CLIP-seq
MIRT2223433	hsa-miR-885-3p	CLIP-seq
MIRT2223434	hsa-miR-9	CLIP-seq
MIRT2223435	hsa-miR-939	CLIP-seq
MIRT2223436	hsa-miR-942	CLIP-seq
MIRT2223437	hsa-miR-98	CLIP-seq
MIRT2223302	hsa-miR-101	CLIP-seq
MIRT2223310	hsa-miR-1298	CLIP-seq
MIRT2223314	hsa-miR-144	CLIP-seq
MIRT1548467	hsa-miR-3945	CLIP-seq
MIRT1548468	hsa-miR-4706	CLIP-seq
MIRT2223396	hsa-miR-4727-5p	CLIP-seq
MIRT1548469	hsa-miR-4734	CLIP-seq
MIRT1548470	hsa-miR-4749-5p	CLIP-seq
MIRT1548471	hsa-miR-4787-5p	CLIP-seq
MIRT1548472	hsa-miR-744	CLIP-seq
MIRT2223294	hsa-let-7a	CLIP-seq
MIRT2223295	hsa-let-7b	CLIP-seq
MIRT2223296	hsa-let-7c	CLIP-seq
MIRT2223297	hsa-let-7d	CLIP-seq
MIRT2223298	hsa-let-7e	CLIP-seq
MIRT2223299	hsa-let-7f	CLIP-seq
MIRT2223300	hsa-let-7g	CLIP-seq
MIRT2223301	hsa-let-7i	CLIP-seq
MIRT2527250	hsa-miR-1184	CLIP-seq
MIRT2223303	hsa-miR-1197	CLIP-seq
MIRT2223304	hsa-miR-1205	CLIP-seq
MIRT2223305	hsa-miR-1224-3p	CLIP-seq
MIRT2527251	hsa-miR-1247	CLIP-seq
MIRT2223308	hsa-miR-1273f	CLIP-seq
MIRT975061	hsa-miR-1470	CLIP-seq
MIRT2527252	hsa-miR-1825	CLIP-seq
MIRT2223317	hsa-miR-1827	CLIP-seq
MIRT2527253	hsa-miR-1909	CLIP-seq
MIRT2223318	hsa-miR-1915	CLIP-seq
MIRT2527254	hsa-miR-1972	CLIP-seq
MIRT2527255	hsa-miR-1976	CLIP-seq
MIRT2527256	hsa-miR-199a-5p	CLIP-seq
MIRT2527257	hsa-miR-199b-5p	CLIP-seq
MIRT2527258	hsa-miR-2909	CLIP-seq
MIRT2223321	hsa-miR-3065-3p	CLIP-seq
MIRT2223325	hsa-miR-3150a-3p	CLIP-seq
MIRT2223326	hsa-miR-3154	CLIP-seq
MIRT975063	hsa-miR-3173-5p	CLIP-seq
MIRT1988903	hsa-miR-3175	CLIP-seq
MIRT2223329	hsa-miR-3179	CLIP-seq
MIRT2223330	hsa-miR-3183	CLIP-seq
MIRT2223331	hsa-miR-3185	CLIP-seq
MIRT2223332	hsa-miR-3189-3p	CLIP-seq
MIRT2527259	hsa-miR-324-5p	CLIP-seq
MIRT2527260	hsa-miR-331-3p	CLIP-seq
MIRT975065	hsa-miR-3614-5p	CLIP-seq
MIRT2527261	hsa-miR-361-5p	CLIP-seq
MIRT2223338	hsa-miR-3620	CLIP-seq
MIRT2527262	hsa-miR-3663-5p	CLIP-seq
MIRT2223341	hsa-miR-3664-3p	CLIP-seq
MIRT2527263	hsa-miR-3689d	CLIP-seq
MIRT2223345	hsa-miR-3690	CLIP-seq
MIRT2527264	hsa-miR-371b-3p	CLIP-seq
MIRT2223347	hsa-miR-3918	CLIP-seq
MIRT2223348	hsa-miR-3922-5p	CLIP-seq
MIRT2527265	hsa-miR-3925-3p	CLIP-seq
MIRT2527266	hsa-miR-3926	CLIP-seq
MIRT2223349	hsa-miR-3943	CLIP-seq
MIRT2527267	hsa-miR-4254	CLIP-seq
MIRT2527268	hsa-miR-4267	CLIP-seq
MIRT2223352	hsa-miR-4268	CLIP-seq
MIRT2527269	hsa-miR-4278	CLIP-seq
MIRT2527270	hsa-miR-4279	CLIP-seq
MIRT2223354	hsa-miR-4290	CLIP-seq
MIRT2527271	hsa-miR-4292	CLIP-seq
MIRT2223355	hsa-miR-4313	CLIP-seq
MIRT2223361	hsa-miR-4435	CLIP-seq
MIRT2223363	hsa-miR-4436b-3p	CLIP-seq
MIRT2223365	hsa-miR-4446-3p	CLIP-seq
MIRT2223366	hsa-miR-4448	CLIP-seq
MIRT2223367	hsa-miR-4457	CLIP-seq
MIRT2223368	hsa-miR-4458	CLIP-seq
MIRT975069	hsa-miR-4469	CLIP-seq
MIRT2223372	hsa-miR-4489	CLIP-seq
MIRT1988904	hsa-miR-4492	CLIP-seq
MIRT1988905	hsa-miR-4498	CLIP-seq
MIRT2223374	hsa-miR-4500	CLIP-seq
MIRT2223375	hsa-miR-4505	CLIP-seq
MIRT2223381	hsa-miR-4632	CLIP-seq
MIRT2223384	hsa-miR-4660	CLIP-seq
MIRT2223385	hsa-miR-4661-3p	CLIP-seq
MIRT975070	hsa-miR-4667-3p	CLIP-seq
MIRT2527272	hsa-miR-4688	CLIP-seq
MIRT2223389	hsa-miR-4693-3p	CLIP-seq
MIRT975071	hsa-miR-4701-5p	CLIP-seq
MIRT2223392	hsa-miR-4721	CLIP-seq
MIRT2223394	hsa-miR-4723-3p	CLIP-seq
MIRT2223395	hsa-miR-4726-3p	CLIP-seq
MIRT1556333	hsa-miR-4728-5p	CLIP-seq
MIRT2223398	hsa-miR-4740-3p	CLIP-seq
MIRT2223408	hsa-miR-4783-3p	CLIP-seq
MIRT2527273	hsa-miR-4793-5p	CLIP-seq
MIRT2527274	hsa-miR-486-3p	CLIP-seq
MIRT2223413	hsa-miR-513a-5p	CLIP-seq
MIRT2223414	hsa-miR-513b	CLIP-seq
MIRT975076	hsa-miR-588	CLIP-seq
MIRT2527275	hsa-miR-596	CLIP-seq
MIRT2223421	hsa-miR-617	CLIP-seq
MIRT2223423	hsa-miR-634	CLIP-seq
MIRT2223424	hsa-miR-642a	CLIP-seq
MIRT2223425	hsa-miR-646	CLIP-seq
MIRT2527276	hsa-miR-662	CLIP-seq
MIRT2223429	hsa-miR-7	CLIP-seq
MIRT1988906	hsa-miR-762	CLIP-seq
MIRT2223430	hsa-miR-766	CLIP-seq
MIRT2223431	hsa-miR-767-3p	CLIP-seq
MIRT2223432	hsa-miR-769-5p	CLIP-seq
MIRT2223433	hsa-miR-885-3p	CLIP-seq
MIRT2223435	hsa-miR-939	CLIP-seq
MIRT2223436	hsa-miR-942	CLIP-seq
MIRT2223437	hsa-miR-98	CLIP-seq
MIRT2223294	hsa-let-7a	CLIP-seq
MIRT2223295	hsa-let-7b	CLIP-seq
MIRT2223296	hsa-let-7c	CLIP-seq
MIRT2223297	hsa-let-7d	CLIP-seq
MIRT2223298	hsa-let-7e	CLIP-seq
MIRT2223299	hsa-let-7f	CLIP-seq
MIRT2223300	hsa-let-7g	CLIP-seq
MIRT2223301	hsa-let-7i	CLIP-seq
MIRT2223302	hsa-miR-101	CLIP-seq
MIRT2527250	hsa-miR-1184	CLIP-seq
MIRT2223303	hsa-miR-1197	CLIP-seq
MIRT2223304	hsa-miR-1205	CLIP-seq
MIRT2223305	hsa-miR-1224-3p	CLIP-seq
MIRT2527251	hsa-miR-1247	CLIP-seq
MIRT2223308	hsa-miR-1273f	CLIP-seq
MIRT2223310	hsa-miR-1298	CLIP-seq
MIRT2223314	hsa-miR-144	CLIP-seq
MIRT975061	hsa-miR-1470	CLIP-seq
MIRT2527252	hsa-miR-1825	CLIP-seq
MIRT2223317	hsa-miR-1827	CLIP-seq
MIRT2527253	hsa-miR-1909	CLIP-seq
MIRT2223318	hsa-miR-1915	CLIP-seq
MIRT2527254	hsa-miR-1972	CLIP-seq
MIRT2527255	hsa-miR-1976	CLIP-seq
MIRT2527256	hsa-miR-199a-5p	CLIP-seq
MIRT2527257	hsa-miR-199b-5p	CLIP-seq
MIRT2527258	hsa-miR-2909	CLIP-seq
MIRT2223321	hsa-miR-3065-3p	CLIP-seq
MIRT2223322	hsa-miR-3115	CLIP-seq
MIRT2223325	hsa-miR-3150a-3p	CLIP-seq
MIRT2223326	hsa-miR-3154	CLIP-seq
MIRT975063	hsa-miR-3173-5p	CLIP-seq
MIRT1988903	hsa-miR-3175	CLIP-seq
MIRT2223329	hsa-miR-3179	CLIP-seq
MIRT2223330	hsa-miR-3183	CLIP-seq
MIRT2223331	hsa-miR-3185	CLIP-seq
MIRT2223332	hsa-miR-3189-3p	CLIP-seq
MIRT2223335	hsa-miR-323-3p	CLIP-seq
MIRT2527259	hsa-miR-324-5p	CLIP-seq
MIRT2527260	hsa-miR-331-3p	CLIP-seq
MIRT975065	hsa-miR-3614-5p	CLIP-seq
MIRT2527261	hsa-miR-361-5p	CLIP-seq
MIRT2223338	hsa-miR-3620	CLIP-seq
MIRT2527262	hsa-miR-3663-5p	CLIP-seq
MIRT2223341	hsa-miR-3664-3p	CLIP-seq
MIRT2527263	hsa-miR-3689d	CLIP-seq
MIRT2223345	hsa-miR-3690	CLIP-seq
MIRT2527264	hsa-miR-371b-3p	CLIP-seq
MIRT2223347	hsa-miR-3918	CLIP-seq
MIRT2223348	hsa-miR-3922-5p	CLIP-seq
MIRT2527265	hsa-miR-3925-3p	CLIP-seq
MIRT2527266	hsa-miR-3926	CLIP-seq
MIRT2223349	hsa-miR-3943	CLIP-seq
MIRT1548467	hsa-miR-3945	CLIP-seq
MIRT2527267	hsa-miR-4254	CLIP-seq
MIRT2527268	hsa-miR-4267	CLIP-seq
MIRT2223352	hsa-miR-4268	CLIP-seq
MIRT2527269	hsa-miR-4278	CLIP-seq
MIRT2527270	hsa-miR-4279	CLIP-seq
MIRT2223354	hsa-miR-4290	CLIP-seq
MIRT2527271	hsa-miR-4292	CLIP-seq
MIRT2223355	hsa-miR-4313	CLIP-seq
MIRT2223365	hsa-miR-4446-3p	CLIP-seq
MIRT2223366	hsa-miR-4448	CLIP-seq
MIRT2223367	hsa-miR-4457	CLIP-seq
MIRT2223368	hsa-miR-4458	CLIP-seq
MIRT975069	hsa-miR-4469	CLIP-seq
MIRT2223372	hsa-miR-4489	CLIP-seq
MIRT1988904	hsa-miR-4492	CLIP-seq
MIRT1988905	hsa-miR-4498	CLIP-seq
MIRT2223374	hsa-miR-4500	CLIP-seq
MIRT2223375	hsa-miR-4505	CLIP-seq
MIRT2223381	hsa-miR-4632	CLIP-seq
MIRT2223384	hsa-miR-4660	CLIP-seq
MIRT2223385	hsa-miR-4661-3p	CLIP-seq
MIRT975070	hsa-miR-4667-3p	CLIP-seq
MIRT2527272	hsa-miR-4688	CLIP-seq
MIRT2223389	hsa-miR-4693-3p	CLIP-seq
MIRT975071	hsa-miR-4701-5p	CLIP-seq
MIRT1548468	hsa-miR-4706	CLIP-seq
MIRT2223392	hsa-miR-4721	CLIP-seq
MIRT2223394	hsa-miR-4723-3p	CLIP-seq
MIRT2223395	hsa-miR-4726-3p	CLIP-seq
MIRT2223396	hsa-miR-4727-5p	CLIP-seq
MIRT1556333	hsa-miR-4728-5p	CLIP-seq
MIRT1548469	hsa-miR-4734	CLIP-seq
MIRT2223398	hsa-miR-4740-3p	CLIP-seq
MIRT1548470	hsa-miR-4749-5p	CLIP-seq
MIRT2223408	hsa-miR-4783-3p	CLIP-seq
MIRT1548471	hsa-miR-4787-5p	CLIP-seq
MIRT2527273	hsa-miR-4793-5p	CLIP-seq
MIRT2527274	hsa-miR-486-3p	CLIP-seq
MIRT2223413	hsa-miR-513a-5p	CLIP-seq
MIRT2223414	hsa-miR-513b	CLIP-seq
MIRT975076	hsa-miR-588	CLIP-seq
MIRT2527275	hsa-miR-596	CLIP-seq
MIRT2223421	hsa-miR-617	CLIP-seq
MIRT2223423	hsa-miR-634	CLIP-seq
MIRT2223424	hsa-miR-642a	CLIP-seq
MIRT2223425	hsa-miR-646	CLIP-seq
MIRT2527276	hsa-miR-662	CLIP-seq
MIRT2223429	hsa-miR-7	CLIP-seq
MIRT1548472	hsa-miR-744	CLIP-seq
MIRT1988906	hsa-miR-762	CLIP-seq
MIRT2223430	hsa-miR-766	CLIP-seq
MIRT2223431	hsa-miR-767-3p	CLIP-seq
MIRT2223432	hsa-miR-769-5p	CLIP-seq
MIRT2223433	hsa-miR-885-3p	CLIP-seq
MIRT2223435	hsa-miR-939	CLIP-seq
MIRT2223436	hsa-miR-942	CLIP-seq
MIRT2223437	hsa-miR-98	CLIP-seq

Show/Hide all (30)

GO ID	Ontology	Definition	Evidence	Reference
GO:0002538	Process	Arachidonate metabolite production involved in inflammatory response	IEA
GO:0004768	Function	Stearoyl-CoA 9-desaturase activity	IEA
GO:0005515	Function	Protein binding	IPI	32296183
GO:0005783	Component	Endoplasmic reticulum	IEA
GO:0005789	Component	Endoplasmic reticulum membrane	IEA
GO:0005789	Component	Endoplasmic reticulum membrane	IEA
GO:0005789	Component	Endoplasmic reticulum membrane	TAS
GO:0005886	Component	Plasma membrane	TAS	9867867
GO:0006629	Process	Lipid metabolic process	IBA
GO:0006629	Process	Lipid metabolic process	IEA
GO:0006631	Process	Fatty acid metabolic process	IEA
GO:0006633	Process	Fatty acid biosynthetic process	IEA
GO:0006636	Process	Unsaturated fatty acid biosynthetic process	IEA
GO:0006636	Process	Unsaturated fatty acid biosynthetic process	TAS	9867867
GO:0016020	Component	Membrane	HDA	19946888
GO:0016020	Component	Membrane	IBA
GO:0016020	Component	Membrane	IEA
GO:0016020	Component	Membrane	TAS	9867867
GO:0016213	Function	Acyl-CoA 6-desaturase activity	IEA
GO:0016213	Function	Acyl-CoA 6-desaturase activity	TAS
GO:0016215	Function	Acyl-CoA desaturase activity	IEA
GO:0016491	Function	Oxidoreductase activity	IEA
GO:0016717	Function	Oxidoreductase activity, acting on paired donors, with oxidation of a pair of donors resulting in the reduction of molecular oxygen to two molecules of water	IBA
GO:0036109	Process	Alpha-linolenic acid metabolic process	IEA
GO:0036109	Process	Alpha-linolenic acid metabolic process	TAS
GO:0042759	Process	Long-chain fatty acid biosynthetic process	IEA
GO:0043651	Process	Linoleic acid metabolic process	IEA
GO:0043651	Process	Linoleic acid metabolic process	TAS
GO:1900409	Process	Positive regulation of cellular response to oxidative stress	IEA
GO:1901570	Process	Fatty acid derivative biosynthetic process	IEA

MIM	HGNC	e!Ensembl
606149	3575	ENSG00000134824

O95864

Protein name

Acyl-CoA 6-desaturase (EC 1.14.19.3) (Delta(6) fatty acid desaturase) (D6D) (Delta(6) desaturase) (Delta-6 desaturase) (Fatty acid desaturase 2)

Protein function

Involved in the biosynthesis of highly unsaturated fatty acids (HUFA) from the essential polyunsaturated fatty acids (PUFA) linoleic acid (LA) (18:2n-6) and alpha-linolenic acid (ALA) (18:3n-3) precursors, acting as a fatty acyl-coenzyme A (CoA)

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00173	Cyt-b5	22 → 95	Cytochrome b5-like Heme/Steroid binding domain	Domain
PF00487	FA_desaturase	156 → 418	Fatty acid desaturase	Domain

Tissue specificity

TISSUE SPECIFICITY: Expressed in a wide array of tissues, highest expression is found in liver followed by brain, lung, heart, and retina. A lower level is found in breast tumor when compared with normal tissues; lowest levels were found in patients with

Sequence

MGKGGNQGEGAAEREVSVPTFSWEEIQKHNLRTDRWLVIDRKVYNITKWSIQHPGGQRVI
GHYAGEDATDAFRAFHPDLEFVGKFLKPLLIGELAPEEPSQDHGKNSKITEDFRALRKTA
EDMNLFKTNHVFFLLLLAHIIALESIAWFTVFYFGNGWIPTLITAFVLATSQAQAGWLQH
DYGHLSVYRKPKWNHLVHKFVIGHLKGASANWWNHRHFQHHAKPNIFHKDPDVNMLHVFV
LGEWQPIEYGKKKLKYLPYNHQHEYFFLIGPPLLIPMYFQYQIIMTMIVHKNWVDLAWAV
SYYIRFFITYIPFYGILGALLFLNFIRFLESHWFVWVTQMNHIVMEIDQEAYRDWFSSQL
TATCNVEQSFFNDWFSGHLNFQIEHHLFPTMPRHNLHKIAPLVKSLCAKHGIEYQEKPLL
RALLDIIRSLKKSGKLWLDAYLHK

Sequence length

444

Interactions

View interactions

	KEGG		Reactome
	alpha-Linolenic acid metabolism Biosynthesis of unsaturated fatty acids Metabolic pathways Fatty acid metabolism PPAR signaling pathway		Linoleic acid (LA) metabolism alpha-linolenic acid (ALA) metabolism

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (60)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
ALZHEIMER DISEASE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ANDROGENETIC ALOPECIA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ANOREXIA NERVOSA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
AORTIC STENOSIS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
AORTIC VALVE CALCIFICATION	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
AORTIC VALVE DISEASE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ASTHMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ATOPIC ECZEMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ATRIAL FIBRILLATION	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ATTENTION DEFICIT HYPERACTIVITY DISORDER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
AUTISM SPECTRUM DISORDER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BASAL CELL CARCINOMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BENIGN NEOPLASM	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BIPOLAR DISORDER	—	CTD, Disgenet, GWAS catalog CTD, Disgenet, GWAS catalog CTD, Disgenet, GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BIPOLAR I DISORDER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BIPOLAR I DISORDER, MOST RECENT EPISODE MANIC	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CANCER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CHOLELITHIASIS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CHRONIC BRONCHITIS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CHRONIC OBSTRUCTIVE PULMONARY DISEASE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
COLOR VISION DISORDER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
COLORECTAL CANCER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
COLORECTAL NEOPLASMS	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CORONARY ARTERY DISEASE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CROHN'S DISEASE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DEPRESSION, BIPOLAR	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DIABETES MELLITUS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
FAMILIAL LIPOPROTEIN LIPASE DEFICIENCY	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
GALLSTONES	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
GOUT	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HEART FAILURE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HEART VALVE DISEASE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HYPERLIPIDEMIA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HYPOTHYROIDISM	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
INFLAMMATORY BOWEL DISEASE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LARYNGEAL SQUAMOUS CELL CARCINOMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LIPIDOSES	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LIPOIDOSIS	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LUNG ADENOCARCINOMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LUNG CANCER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LUNG CARCINOMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MAJOR DEPRESSIVE DISORDER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
METABOLIC DISEASE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
METABOLIC SYNDROME	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MIXED BIPOLAR I DISORDER	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
NASAL CAVITY POLYP	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
NON-MELANOMA SKIN CARCINOMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OBSESSIVE-COMPULSIVE DISORDER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
RESPIRATORY SYSTEM DISEASE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
RHEUMATOID ARTHRITIS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SCHIZOPHRENIA	—	Disgenet, GWAS catalog Disgenet, GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SKIN CANCER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SKIN NEOPLASM	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
STROKE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TOURETTE SYNDROME	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TYPE 1 DIABETES MELLITUS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TYPE 2 DIABETES MELLITUS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ULCERATIVE COLITIS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
VENOUS THROMBOEMBOLISM	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
VITILIGO	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (146)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Acute Coronary Syndrome	Coronary Syndrome	BEFREE	23555103		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of large intestine	Colorectal Cancer	GWASCAT_DG	29471430, 29917119, 31089142		★★★★★ ★☆☆☆☆ Found in Text Mining only
Age related macular degeneration	Age-related macular degeneration	BEFREE	24346170		★★★★★ ★☆☆☆☆ Found in Text Mining only
Allergic sensitization	Allergic Sensitization	BEFREE	21793953		★★★★★ ★☆☆☆☆ Found in Text Mining only
Alopecia	Alopecia	GWASCAT_DG	28196072		★★★★★ ★☆☆☆☆ Found in Text Mining only
Aortic Valve Stenosis	Aortic valve stenosis	Pubtator	32186652	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Arteriosclerosis	Arteriosclerosis	BEFREE	25921305		★★★★★ ★☆☆☆☆ Found in Text Mining only
Arthritis Rheumatoid	Rheumatoid arthritis	Pubtator	29193869	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Arthritis, Psoriatic	Psoriatic Arthritis	BEFREE	19944404		★★★★★ ★☆☆☆☆ Found in Text Mining only
Asthma	Asthma	BEFREE	21933193, 24934276		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Asthma	Asthma	Pubtator	24934276	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Asthma	Asthma	GWASCAT_DG	31619474		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Atherosclerosis	Atherosclerosis	BEFREE	25921305		★★★★★ ★☆☆☆☆ Found in Text Mining only
Atrial Fibrillation	Atrial Fibrillation	GWASCAT_DG	27790247		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Attention deficit hyperactivity disorder	Attention Deficit Hyperactivity Disorder	BEFREE	16893529		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Autism Spectrum Disorder	Autism	Pubtator	30180836	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Autism Spectrum Disorder	Autism	Pubtator	30180836	Inhibit	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Autism Spectrum Disorders	Autism Spectrum Disorder	BEFREE	30180836		★★★★★ ★☆☆☆☆ Found in Text Mining only
Bipolar Disorder	Bipolar Disorder	BEFREE	20615514		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Bipolar Disorder	Bipolar Disorder	PSYGENET_DG	20615514		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Bipolar Disorder	Bipolar disorder	Pubtator	20615514, 28115744, 30531795	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Bipolar Disorder	Bipolar Disorder	GWASCAT_DG	28115744, 31043756		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Bipolar Disorder	Bipolar Disorder	CTD_human_DG	31043756		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Breast Carcinoma	Breast Carcinoma	BEFREE	12851727		★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	26656090, 37122728	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Basal Cell	Basal cell carcinoma	Pubtator	36496446	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Renal Cell	Renal cell carcinoma	Pubtator	33221754	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Squamous Cell	Squamous cell carcinoma	Pubtator	36496446	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cardiovascular Diseases	Cardiovascular Diseases	LHGDN	18320251		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cardiovascular Diseases	Cardiovascular Diseases	BEFREE	25038994, 29956189		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cardiovascular Diseases	Cardiovascular disease	Pubtator	28253292, 35796550	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cerebral Infarction	Ischemic stroke	Pubtator	26261632, 35796550, 36193932	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cerebrovascular accident	Stroke	GWASCAT_DG	27790247		★★★★★ ★☆☆☆☆ Found in Text Mining only
Chronic Disease	Chronic disease	Pubtator	29746616	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Chronic Kidney Diseases	Kidney Disease	GWASCAT_DG	29545352		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cleft Lip	Cleft lip	Pubtator	36008388	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cognitive Dysfunction	Cognition disorder	Pubtator	27273350	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	CTD_human_DG	24836286		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	GWASDB_DG	24836286		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	GWASCAT_DG	29471430, 29917119, 31089142		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal Neoplasms	CTD_human_DG	24836286		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	28506205, 32486849, 35779418, 36696241, 40430008	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Colorectal Neoplasms	Colorectal Neoplasms	GWASCAT_DG	29471430, 29917119, 31089142		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Coronary Arteriosclerosis	Coronary Arteriosclerosis	BEFREE	26261632, 27004414, 31781193		★★★★★ ★☆☆☆☆ Found in Text Mining only
Coronary Artery Disease	Coronary artery disease	Pubtator	18842780, 23383292, 26261632, 27004414	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Coronary Artery Disease	Coronary artery disease	BEFREE	21917437, 26261632, 27004414, 31781193		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Coronary Artery Disease	Coronary artery disease	Pubtator	32731631	Stimulate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Coronary Disease	Coronary artery disease	Pubtator	21347282	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Coronary heart disease	Coronary Heart Disease	BEFREE	20558833, 22911844, 26261632, 27004414, 31781193		★★★★★ ★☆☆☆☆ Found in Text Mining only
Coronary heart disease	Coronary Heart Disease	GWASDB_DG	21347282		★★★★★ ★☆☆☆☆ Found in Text Mining only
Coronary heart disease	Coronary Heart Disease	GWASCAT_DG	27790247		★★★★★ ★☆☆☆☆ Found in Text Mining only
Crohn Disease	Crohn Disease	BEFREE	24406470		★★★★★ ★☆☆☆☆ Found in Text Mining only
Crohn Disease	Crohn Disease	GWASCAT_DG	28067908		★★★★★ ★☆☆☆☆ Found in Text Mining only
Crohn Disease	Crohn disease	Pubtator	31956234	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Depressed bipolar I disorder	Depressed bipolar disorder	GWASCAT_DG	31043756		★★★★★ ★☆☆☆☆ Found in Text Mining only
Depression, Bipolar	Bipolar Disorder	CTD_human_DG	31043756		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Dermatitis Atopic	Atopic dermatitis	Pubtator	24167612	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Dermatitis, Atopic	Dermatitis	BEFREE	30065580		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes	Diabetes	GWASCAT_DG	27790247		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes	Diabetes	BEFREE	30103922		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes mellitus	Pubtator	20980488, 24294133, 27322064, 27406814	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Diabetes Mellitus	Diabetes Mellitus	GWASCAT_DG	27790247		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Diabetes Mellitus	Diabetes Mellitus	BEFREE	30103922		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Diabetes Mellitus Type 2	Diabetes mellitus, type 2	Pubtator	27004414, 27322064, 28555039, 32731631, 34162950, 34394238, 36412559	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus Type 2	Diabetes mellitus, type 2	Pubtator	29233142	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Non-Insulin-Dependent	Diabetes Mellitus	BEFREE	25981324, 26750116, 27004414, 29937909, 30180967		★★★★★ ★☆☆☆☆ Found in Text Mining only
Disorder of macula of retina	Disorder Of Macula Of Retina	BEFREE	23404124		★★★★★ ★☆☆☆☆ Found in Text Mining only
Dyslipidemias	Dyslipidemias	Pubtator	19060906, 26879377, 29746616	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Dyslipidemias	Dyslipidemias	BEFREE	20364269		★★★★★ ★☆☆☆☆ Found in Text Mining only
Eczema	Eczema	BEFREE	20948998, 30065580		★★★★★ ★☆☆☆☆ Found in Text Mining only
Eczema	Eczema	Pubtator	20948998	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Endometriosis	Endometriosis	Pubtator	38012607	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Erectile Dysfunction	Erectile dysfunction	Pubtator	29233142	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Fatty Liver	Fatty Liver	BEFREE	25921305		★★★★★ ★☆☆☆☆ Found in Text Mining only
Fatty Liver Disease	Fatty Liver	BEFREE	27085774		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	BEFREE	30584371		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	Pubtator	32392704, 37158834	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma Multiforme	Glioblastoma	BEFREE	30584371		★★★★★ ★☆☆☆☆ Found in Text Mining only
Heart failure	Heart Failure	GWASCAT_DG	27790247		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Heart Failure	Heart failure	Pubtator	31059043	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HEMOCHROMATOSIS, TYPE 1	Hemochromatosis	BEFREE	28334935		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypertension	Hypertension	Pubtator	27589269	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypothyroidism	Hypothyroidism	GWASCAT_DG	30595370		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Inflammatory Bowel Diseases	Inflammatory Bowel Disease	GWASDB_DG	23128233		★★★★★ ★☆☆☆☆ Found in Text Mining only
Inflammatory Bowel Diseases	Inflammatory Bowel Disease	GWASCAT_DG	23128233, 26192919		★★★★★ ★☆☆☆☆ Found in Text Mining only
Inflammatory Bowel Diseases	Inflammatory bowel disease	Pubtator	36430859	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Insulin Resistance	Diabetes mellitus, type 2	Pubtator	26087292, 34394238, 36788508	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Ischemic stroke	Ischemic Stroke	BEFREE	26261632		★★★★★ ★☆☆☆☆ Found in Text Mining only
Kidney Diseases	Kidney Disease	BEFREE	25329159		★★★★★ ★☆☆☆☆ Found in Text Mining only
Kidney Diseases	Kidney disease	Pubtator	25329159	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Kidney Failure, Chronic	Kidney Failure	GWASCAT_DG	29545352		★★★★★ ★☆☆☆☆ Found in Text Mining only
Laryngeal Squamous Cell Carcinoma	Laryngeal Carcinoma	GWASCAT_DG	25194280		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Lipoidosis	Lipoidosis	CTD_human_DG	21123845		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Liver carcinoma	Liver carcinoma	BEFREE	19513560		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic metastasis	Pubtator	36696241	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Macular Degeneration	Macular degeneration	Pubtator	24346170	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Major Depressive Disorder	Mental Depression	BEFREE	20863572, 26513616		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Malignant neoplasm of breast	Breast Cancer	BEFREE	12851727		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of large intestine	Colorectal Neoplasms	GWASCAT_DG	29471430, 29917119, 31089142		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of lung	Lung Cancer	GWASDB_DG	21725308		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of stomach	Stomach Neoplasms	BEFREE	29491470		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	20691134, 22140540, 29886893		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	GWASCAT_DG	27790247		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant tumor of colon	Colonic Neoplasms	GWASCAT_DG	29471430, 29917119, 31089142		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malnutrition	Malnutrition	BEFREE	29956189		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	BEFREE	12851727		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	LHGDN	12851727		★★★★★ ★☆☆☆☆ Found in Text Mining only
Manic	Manic Disorder	CTD_human_DG	31043756		★★★★★ ★☆☆☆☆ Found in Text Mining only
Manic Disorder	Manic Disorder	CTD_human_DG	31043756		★★★★★ ★☆☆☆☆ Found in Text Mining only
Metabolic Diseases	Metabolic syndrome	Pubtator	28253292	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Metabolic Syndrome	Metabolic syndrome	Pubtator	36496446, 38394918	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Metabolic Syndrome X	Metabolic Syndrome	BEFREE	19144731, 29779171		★★★★★ ★☆☆☆☆ Found in Text Mining only
Metabolic Syndrome X	Metabolic Syndrome	GWASDB_DG	20694148		★★★★★ ★☆☆☆☆ Found in Text Mining only
Metabolic Syndrome X	Metabolic Syndrome	GWASCAT_DG	20694148		★★★★★ ★☆☆☆☆ Found in Text Mining only
Multiple Sclerosis	Multiple sclerosis	Pubtator	33063621	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Multiple Sclerosis	Multiple sclerosis	Pubtator	33063621	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Myocardial Infarction	Myocardial Infarction	BEFREE	17284757		★★★★★ ★☆☆☆☆ Found in Text Mining only
Myocardial Infarction	Myocardial Infarction	LHGDN	17284757		★★★★★ ★☆☆☆☆ Found in Text Mining only
Myocardial Infarction	Myocardial infarction	Pubtator	17284757	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Necrosis	Necrosis	Pubtator	32392704	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	28506205, 30584371		★★★★★ ★☆☆☆☆ Found in Text Mining only
Non-alcoholic Fatty Liver Disease	Non-Alcoholic Fatty Liver Disease	BEFREE	28759573, 29873593, 30654845, 31255630, 31781193		★★★★★ ★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	Pubtator	16908951, 24294133, 26609056, 27322064, 28598979, 30654845, 32584610, 33494132, 34611217, 35773659, 35779418, 36788508	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	BEFREE	28145068		★★★★★ ★☆☆☆☆ Found in Text Mining only
Obesity Abdominal	Obesity	Pubtator	28125662	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Orofacial Cleft 1	Orofacial cleft	Pubtator	36008388	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteosarcoma	Osteosarcoma	Pubtator	40593006	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasms	Pancreatic neoplasm	Pubtator	24294133	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Peripheral Arterial Disease	Peripheral arterial disease	Pubtator	35796550	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Polycystic Ovary Syndrome	Polycystic Ovary Syndrome	BEFREE	26879377		★★★★★ ★☆☆☆☆ Found in Text Mining only
Polycystic Ovary Syndrome	Polycystic ovary syndrome	Pubtator	26879377	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Progressive pseudorheumatoid dysplasia	Progressive Pseudorheumatoid Dysplasia	BEFREE	20395685		★★★★★ ★☆☆☆☆ Found in Text Mining only
Rheumatoid Arthritis	Rheumatoid arthritis	GWASDB_DG	19503088, 24390342		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Rheumatoid Arthritis	Rheumatoid arthritis	GWASCAT_DG	24390342, 30423114		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Schizophrenia	Schizophrenia	BEFREE	19195843		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Schizophrenia	Schizophrenia	PSYGENET_DG	19195843		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Steatohepatitis	Fatty Liver	BEFREE	25921305		★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Carcinoma	Stomach Carcinoma	BEFREE	29491470		★★★★★ ★☆☆☆☆ Found in Text Mining only
Stroke	Stroke	Pubtator	36193932	Inhibit	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Stroke	Stroke	Pubtator	36193932	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Unipolar Depression	Mental Depression	BEFREE	26513616		★★★★★ ★☆☆☆☆ Found in Text Mining only
Urinary Bladder Neoplasms	Urinary bladder neoplasms	Pubtator	34418989	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Vascular System Injuries	Vascular system injury	Pubtator	18842780	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Venous Thromboembolism	Venous thromboembolism	Pubtator	35796550	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Ventricular Remodeling	Ventricular remodeling	Pubtator	31532795	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Vitiligo	Vitiligo	GWASCAT_DG	27723757		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

FADS2 (fatty acid desaturase 2)