Gene Gene information from NCBI Gene database.
Entrez ID 94107
Gene name Transmembrane protein 203
Gene symbol TMEM203
Synonyms (NCBI Gene)
HBEBP1
Chromosome 9
Chromosome location 9q34.3
miRNA miRNA information provided by mirtarbase database.
254
miRTarBase ID miRNA Experiments Reference
MIRT040845 hsa-miR-18a-3p CLASH 23622248
MIRT1435076 hsa-miR-101 CLIP-seq
MIRT1435077 hsa-miR-1200 CLIP-seq
MIRT1435078 hsa-miR-1301 CLIP-seq
MIRT1435079 hsa-miR-1324 CLIP-seq
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
14
GO ID Ontology Definition Evidence Reference
GO:0005515 Function Protein binding IPI 25996873, 32296183
GO:0005764 Component Lysosome IEA
GO:0005765 Component Lysosomal membrane IEA
GO:0005783 Component Endoplasmic reticulum IBA
GO:0005783 Component Endoplasmic reticulum IDA 25996873
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
MIM HGNC e!Ensembl
616499 28217 ENSG00000187713
Protein Protein information from UniProt database.
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q969S6
Protein name Transmembrane protein 203
Protein function Involved in the regulation of cellular calcium homeotasis (PubMed:25996873). Required for spermatogenesis (PubMed:25996873). Acts as a regulator of STING-mediated inflammatory signaling in macrophages (PubMed:31346090). Forms a complex with STIN
Family and domains
Tissue specificity TISSUE SPECIFICITY: Increased expression seen in T-lymphocytes from patients with systemic lupus erythematosus (SLE). {ECO:0000269|PubMed:25996873}.
Sequence
MLFSLRELVQWLGFATFEIFVHLLALLVFSVLLALRVDGLVPGLSWWNVFVPFFAADGLS
TYFTTIVSVRLFQDGEKRLAVLRLFWVLTVLSLKFVFEMLLCQKLAEQTRELWFGLITSP
LFILLQLLMIRACRVN
Sequence length 136
Interactions View interactions
Associated diseases Disease associations from ClinVar (causal & non-causal) and other databases (OMIM, Orphanet, GWAS, etc.).
1
Evidence Score: ★☆☆☆☆  Gene-disease association found in Text Mining only ★★☆☆☆  Found in Text Mining and Unknown/Other Associations ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
Phenotype Name Clinical Significance Source Evidence Score
DEAFNESS, AUTOSOMAL RECESSIVE 79 Disgenet
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
Associations from Text Mining Disease associations identified through text mining
Disease Name Disease (Merged) Source PMID Relationship Type Evidence Score
Lupus Erythematosus Systemic Systemic lupus erythematosus Pubtator 31346090 Associate
★☆☆☆☆
Found in Text Mining only