CD80 (CD80 molecule)

Gene

• Entrez ID: 941
• Gene name: CD80 molecule
• Gene symbol: CD80
• Synonyms (NCBI Gene): B7, B7-1, B7.1, BB1, CD28LG, CD28LG1, LAB7
• Chromosome: 3
• Chromosome location: 3q13.33
• Summary: The protein encoded by this gene is a membrane receptor that is activated by the binding of CD28 or CTLA-4. The activated protein induces T-cell proliferation and cytokine production. This protein can act as a receptor for adenovirus subgroup B and may pl

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT021278	hsa-miR-146a-5p	Other	20375304
MIRT021278	hsa-miR-146a-5p	Immunohistochemistry, Luciferase reporter assay, qRT-PCR, Western blot	26505653
MIRT021278	hsa-miR-146a-5p	Immunohistochemistry, Luciferase reporter assay, qRT-PCR, Western blot	26505653
MIRT876186	hsa-let-7a	CLIP-seq
MIRT876187	hsa-let-7b	CLIP-seq
MIRT876188	hsa-let-7c	CLIP-seq
MIRT876189	hsa-let-7d	CLIP-seq
MIRT876190	hsa-let-7e	CLIP-seq
MIRT876191	hsa-let-7f	CLIP-seq
MIRT876192	hsa-let-7g	CLIP-seq
MIRT876193	hsa-let-7i	CLIP-seq
MIRT876194	hsa-miR-103a	CLIP-seq
MIRT876195	hsa-miR-107	CLIP-seq
MIRT876196	hsa-miR-1294	CLIP-seq
MIRT876197	hsa-miR-15a	CLIP-seq
MIRT876198	hsa-miR-15b	CLIP-seq
MIRT876199	hsa-miR-16	CLIP-seq
MIRT876200	hsa-miR-195	CLIP-seq
MIRT876201	hsa-miR-202	CLIP-seq
MIRT876202	hsa-miR-3148	CLIP-seq
MIRT876203	hsa-miR-3174	CLIP-seq
MIRT876204	hsa-miR-3611	CLIP-seq
MIRT876205	hsa-miR-3688-3p	CLIP-seq
MIRT876206	hsa-miR-424	CLIP-seq
MIRT876207	hsa-miR-4458	CLIP-seq
MIRT876208	hsa-miR-4464	CLIP-seq
MIRT876209	hsa-miR-4500	CLIP-seq
MIRT876210	hsa-miR-4694-3p	CLIP-seq
MIRT876211	hsa-miR-4748	CLIP-seq
MIRT876212	hsa-miR-497	CLIP-seq
MIRT876213	hsa-miR-522	CLIP-seq
MIRT876214	hsa-miR-758	CLIP-seq
MIRT876215	hsa-miR-921	CLIP-seq
MIRT876216	hsa-miR-98	CLIP-seq

Transcription factors

Transcription factor	Regulation	Reference
BCL6	Repression	12860928
IRF7	Activation	16237059
NFKB1	Activation	11359799;12860928
RELA	Activation	11359799;12860928
TRERF1	Repression	18652845

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001618	Function	Virus receptor activity	IEA
GO:0002376	Process	Immune system process	IEA
GO:0002682	Process	Regulation of immune system process	IEA
GO:0002710	Process	Negative regulation of T cell mediated immunity	IDA	11015443
GO:0005515	Function	Protein binding	IPI	9915850, 11279502, 18585785, 20587542, 21982860, 23417675, 31000591
GO:0005886	Component	Plasma membrane	IC	11279502, 24845157
GO:0005886	Component	Plasma membrane	IEA
GO:0005886	Component	Plasma membrane	NAS	1370389
GO:0005886	Component	Plasma membrane	TAS
GO:0006955	Process	Immune response	IBA
GO:0007166	Process	Cell surface receptor signaling pathway	IBA
GO:0009897	Component	External side of plasma membrane	IBA
GO:0009967	Process	Positive regulation of signal transduction	NAS	9915850
GO:0009986	Component	Cell surface	HDA	23981064
GO:0015026	Function	Coreceptor activity	IEA
GO:0015026	Function	Coreceptor activity	NAS	9915850
GO:0016020	Component	Membrane	IEA
GO:0031295	Process	T cell costimulation	IBA
GO:0031295	Process	T cell costimulation	IDA	8484124
GO:0031295	Process	T cell costimulation	IEA
GO:0032725	Process	Positive regulation of granulocyte macrophage colony-stimulating factor production	NAS	9915850
GO:0032743	Process	Positive regulation of interleukin-2 production	NAS	9915850
GO:0035556	Process	Intracellular signal transduction	NAS	9915850
GO:0042102	Process	Positive regulation of T cell proliferation	IBA
GO:0042110	Process	T cell activation	IDA	7568038, 7737275, 23918985
GO:0042110	Process	T cell activation	IDA	23918985
GO:0042130	Process	Negative regulation of T cell proliferation	IBA
GO:0045627	Process	Positive regulation of T-helper 1 cell differentiation	NAS	9915850
GO:0045893	Process	Positive regulation of DNA-templated transcription	NAS	9915850
GO:0046718	Process	Symbiont entry into host cell	IEA
GO:0048018	Function	Receptor ligand activity	IDA	24845157
GO:0050731	Process	Positive regulation of peptidyl-tyrosine phosphorylation	IDA	9915850
GO:0071222	Process	Cellular response to lipopolysaccharide	IBA
GO:0098636	Component	Protein complex involved in cell adhesion	IDA	7544393

Other IDs

• MIM: 112203
• HGNC: 1700
• e!Ensembl: ENSG00000121594

Protein

• UniProt ID: P33681
• Protein name: T-lymphocyte activation antigen CD80 (Activation B7-1 antigen) (BB1) (CTLA-4 counter-receptor B7.1) (B7) (CD antigen CD80)
• Protein function: Costimulatory molecule that belongs to the immunoglobulin superfamily that plays an important role in T-lymphocyte activation (PubMed:38467718). Acts as the primary auxiliary signal augmenting the MHC/TCR signal in naive T-cells together with th
• PDB: 1DR9, 1I8L, 7TPS, 8FXW, 8FXZ, 8HXA
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF07686	V-set	36 → 135	Immunoglobulin V-set domain	Domain
  PF08205	C2-set_2	141 → 227	CD80-like C2-set immunoglobulin domain	Domain

• Tissue specificity: TISSUE SPECIFICITY: Expressed on activated B-cells, macrophages and dendritic cells.
• Sequence:

  MGHTRRQGTSPSKCPYLNFFQLLVLAGLSHFCSGVIHVTKEVKEVATLSCGHNVSVEELA
  QTRIYWQKEKKMVLTMMSGDMNIWPEYKNRTIFDITNNLSIVILALRPSDEGTYECVVLK
  YEKDAFKREHLAEVTLSVKADFPTPSISDFEIPTSNIRRIICSTSGGFPEPHLSWLENGE
  ELNAINTTVSQDPETELYAVSSKLDFNMTTNHSFMCLIKYGHLRVNQTFNWNTTKQEHFP
  DNLLPSWAITLISVNGIFVICCLTYCFAPRCRERRRNERLRRESVRPV

• Sequence length: 288

Pathways

KEGG:

Virion - Adenovirus
Cell adhesion molecules
Toll-like receptor signaling pathway
Intestinal immune network for IgA production
Type I diabetes mellitus
Autoimmune thyroid disease
Systemic lupus erythematosus
Rheumatoid arthritis
Allograft rejection
Graft-versus-host disease
Viral myocarditis

Reactome:

PIP3 activates AKT signaling
Constitutive Signaling by Aberrant PI3K in Cancer
CD28 co-stimulation
CD28 dependent PI3K/Akt signaling
CD28 dependent Vav1 pathway
CTLA4 inhibitory signaling
Interleukin-10 signaling
PI5P, PP2A and IER3 Regulate PI3K/AKT Signaling

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
ASTHMA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BILIARY CIRRHOSIS	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CELIAC DISEASE	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DIABETES MELLITUS, INSULIN-DEPENDENT	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HYPOTHYROIDISM	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LIVER CIRRHOSIS, BILIARY	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MULTIPLE SCLEROSIS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PRIMARY BILIARY CHOLANGITIS	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SYSTEMIC LUPUS ERYTHEMATOSUS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
VITILIGO	—	CTD, Disgenet, GWAS catalog CTD, Disgenet, GWAS catalog CTD, Disgenet, GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Acute Coronary Syndrome	Coronary Syndrome	BEFREE	24107715		★☆☆☆☆ Found in Text Mining only
Acute lymphocytic leukemia	Lymphocytic Leukemia	BEFREE	10942373, 21492747		★☆☆☆☆ Found in Text Mining only
Acute monocytic leukemia	Monocytic Leukemia	BEFREE	15585413, 30482760		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma	Adenocarcinoma	BEFREE	15254047, 31161312		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of lung (disorder)	Lung adenocarcinoma	BEFREE	19799608, 31159869		★☆☆☆☆ Found in Text Mining only
Adenoma	Adenoma	BEFREE	29277562		★☆☆☆☆ Found in Text Mining only
Adult Acute Lymphocytic Leukemia	Lymphocytic Leukemia	BEFREE	10942373, 21492747		★☆☆☆☆ Found in Text Mining only
Allergic rhinitis (disorder)	Allergic rhinitis	BEFREE	30449135		★☆☆☆☆ Found in Text Mining only
Alzheimer Disease	Alzheimer disease	Pubtator	23891730	Stimulate	★☆☆☆☆ Found in Text Mining only
ANOPHTHALMIA AND PULMONARY HYPOPLASIA	Syndromic microphthalmia	BEFREE	28856392		★☆☆☆☆ Found in Text Mining only
Arteriosclerosis	Arteriosclerosis	BEFREE	27430577		★☆☆☆☆ Found in Text Mining only
Arthritis	Arthritis	Pubtator	34691053	Associate	★☆☆☆☆ Found in Text Mining only
Arthritis	Arthritis	BEFREE	7535211		★☆☆☆☆ Found in Text Mining only
Arthritis Psoriatic	Psoriatic arthritis	Pubtator	16507115	Associate	★☆☆☆☆ Found in Text Mining only
Arthritis Psoriatic	Psoriatic arthritis	Pubtator	35095831	Stimulate	★☆☆☆☆ Found in Text Mining only
Arthritis Rheumatoid	Rheumatoid arthritis	Pubtator	11037875, 12417058, 26980135, 32048307, 32228715	Associate	★☆☆☆☆ Found in Text Mining only
Arthritis Rheumatoid	Rheumatoid arthritis	Pubtator	17328044	Stimulate	★☆☆☆☆ Found in Text Mining only
Arthritis, Psoriatic	Psoriatic Arthritis	BEFREE	16507115		★☆☆☆☆ Found in Text Mining only
Asthma	Asthma	BEFREE	22192168		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Atherosclerosis	Atherosclerosis	BEFREE	27430577		★☆☆☆☆ Found in Text Mining only
Autoimmune Diseases	Autoimmune Diseases	BEFREE	10477593, 21715687, 21978690, 23661460, 28747139, 30830871		★☆☆☆☆ Found in Text Mining only
Autoimmune Diseases	Autoimmune disease	Pubtator	23661460, 33193306, 7500044	Associate	★☆☆☆☆ Found in Text Mining only
B-Cell Lymphomas	B-Cell Lymphoma	LHGDN	11726649		★☆☆☆☆ Found in Text Mining only
B-Cell Lymphomas	B-Cell Lymphoma	BEFREE	14511234		★☆☆☆☆ Found in Text Mining only
B-CELL MALIGNANCY, LOW-GRADE	Lymphocytic Leukemia	BEFREE	10520003		★☆☆☆☆ Found in Text Mining only
Barrett Esophagus	Barrett esophagus	BEFREE	31646078		★☆☆☆☆ Found in Text Mining only
Behcet Syndrome	Behcet disease	Pubtator	37003592	Associate	★☆☆☆☆ Found in Text Mining only
Biliary cirrhosis	Biliary cirrhosis	CTD_human_DG	21399635		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Biliary Cirrhosis, Primary, 1	Biliary cirrhosis	CTD_human_DG	21399635		★☆☆☆☆ Found in Text Mining only
Bladder Neoplasm	Bladder Neoplasm	BEFREE	10209504		★☆☆☆☆ Found in Text Mining only
Brain Neoplasms	Brain Neoplasms	BEFREE	10417770		★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	10359208, 10359214, 10374432, 11477456, 15365776, 21394107, 24080446, 26881506, 30411299		★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	12616108, 15365776, 26942414, 36482233, 37643511	Associate	★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	31552680	Inhibit	★☆☆☆☆ Found in Text Mining only
Bronchiolitis	Bronchiolitis	Pubtator	18256061	Associate	★☆☆☆☆ Found in Text Mining only
Burkitt Lymphoma	Burkitt lymphoma	Pubtator	17659054	Associate	★☆☆☆☆ Found in Text Mining only
Carcinogenesis	Carcinogenesis	Pubtator	27377375, 30813210	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Endometrioid	Endometrioid carcinoma	Pubtator	23382860	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	15965645, 18793383, 21674477, 40410708	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma of bladder	Bladder carcinoma	BEFREE	10209504		★☆☆☆☆ Found in Text Mining only
Carcinoma of lung	Lung carcinoma	BEFREE	11267941, 11422893		★☆☆☆☆ Found in Text Mining only
Carcinoma Pancreatic Ductal	Pancreatic ductal carcinoma	Pubtator	33505218	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Renal Cell	Renal cell carcinoma	Pubtator	10447932	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Squamous Cell	Squamous cell carcinoma	Pubtator	34907653, 36922519	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Transitional Cell	Transitional cell carcinoma	Pubtator	10209504	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma, Ovarian Epithelial	Ovarian Epithelial carcinoma	BEFREE	10359208, 10606960, 11860540, 14715418		★☆☆☆☆ Found in Text Mining only
Carcinomatosis of peritoneal cavity	Peritoneal Carcinomatosis	BEFREE	10606960		★☆☆☆☆ Found in Text Mining only
Cardiomyopathies	Cardiomyopathy	Pubtator	16584112	Associate	★☆☆☆☆ Found in Text Mining only
Celiac Disease	Celiac disease	BEFREE	12121279		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Celiac Disease	Celiac disease	Pubtator	18395083, 20190752	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Celiac Disease	Celiac disease	CTD_human_DG	20190752		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
cervical cancer	Cervical Cancer	BEFREE	9159336		★☆☆☆☆ Found in Text Mining only
Cervical Intraepithelial Neoplasia	Cervical Intraepithelial Neoplasia	BEFREE	23521696		★☆☆☆☆ Found in Text Mining only
Cervix carcinoma	Cervix carcinoma	BEFREE	9159336		★☆☆☆☆ Found in Text Mining only
Childhood Acute Lymphoblastic Leukemia	Lymphoblastic Leukemia	BEFREE	10942373, 21492747		★☆☆☆☆ Found in Text Mining only
Chronic kidney disease stage 5	Kidney Disease	BEFREE	30499177		★☆☆☆☆ Found in Text Mining only
Chronic Kidney Diseases	Kidney Disease	BEFREE	30499177, 30672713		★☆☆☆☆ Found in Text Mining only
Chronic Lymphocytic Leukemia	Lymphocytic Leukemia	BEFREE	10520003, 15946308, 23154584, 30910862, 8977261		★☆☆☆☆ Found in Text Mining only
Chronic Obstructive Airway Disease	Chronic Obstructive Pulmonary Disease	BEFREE	15802338, 21910726, 31556347		★☆☆☆☆ Found in Text Mining only
Colitis Ulcerative	Ulcerative colitis	Pubtator	10896913, 12699425, 32872480	Associate	★☆☆☆☆ Found in Text Mining only
Colitis Ulcerative	Ulcerative colitis	Pubtator	24347371	Inhibit	★☆☆☆☆ Found in Text Mining only
Colitis Ulcerative	Ulcerative colitis	Pubtator	26706980	Stimulate	★☆☆☆☆ Found in Text Mining only
Colon Carcinoma	Colon Carcinoma	BEFREE	12100028, 31072360		★☆☆☆☆ Found in Text Mining only
Colonic Neoplasms	Colonic neoplasm	Pubtator	12100028, 33868791	Associate	★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	26496037		★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	12100028, 39456247, 9640250	Associate	★☆☆☆☆ Found in Text Mining only
Conventional (Clear Cell) Renal Cell Carcinoma	Renal Carcinoma	BEFREE	10854153, 11175312, 7545143		★☆☆☆☆ Found in Text Mining only
Coronary Artery Disease	Coronary artery disease	LHGDN	17925605		★☆☆☆☆ Found in Text Mining only
Coronary Vasospasm	Coronary vasospasm	Pubtator	35096275	Associate	★☆☆☆☆ Found in Text Mining only
Crohn Disease	Crohn disease	Pubtator	12594843, 26706980	Stimulate	★☆☆☆☆ Found in Text Mining only
Crohn Disease	Crohn disease	Pubtator	12699425, 14678275, 32872480, 38310086	Associate	★☆☆☆☆ Found in Text Mining only
Crohn Disease	Crohn Disease	BEFREE	26706980		★☆☆☆☆ Found in Text Mining only
Dermatitis Allergic Contact	Allergic contact dermatitis	Pubtator	7523532	Associate	★☆☆☆☆ Found in Text Mining only
Dermatitis Atopic	Atopic dermatitis	Pubtator	11028864	Stimulate	★☆☆☆☆ Found in Text Mining only
Dermatitis Atopic 1	Atopic dermatitis	Pubtator	11028864	Associate	★☆☆☆☆ Found in Text Mining only
Dermatitis Contact	Contact dermatitis	Pubtator	10844549	Associate	★☆☆☆☆ Found in Text Mining only
Dermatitis, Allergic Contact	Dermatitis	BEFREE	15558838		★☆☆☆☆ Found in Text Mining only
Dermatitis, Irritant	Dermatitis	BEFREE	10844549		★☆☆☆☆ Found in Text Mining only
Diabetes	Diabetes	BEFREE	17376836, 17947667		★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes Mellitus	BEFREE	17376836, 17947667		★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes mellitus	Pubtator	29513874	Inhibit	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus Type 1	Diabetes mellitus, type 1	Pubtator	11927616, 34153873	Associate	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus Type 1	Diabetes mellitus, type 1	Pubtator	32483133	Stimulate	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Insulin-Dependent	Diabetes Mellitus	BEFREE	23911738, 31612266, 8816976, 9725265		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Diabetic Nephropathies	Diabetic neuropathy	Pubtator	33958973	Associate	★☆☆☆☆ Found in Text Mining only
Diabetic Nephropathy	Diabetic Nephropathy	BEFREE	28339909		★☆☆☆☆ Found in Text Mining only
Disorder of eye	Disorder Of Eye	BEFREE	30404803, 31619558		★☆☆☆☆ Found in Text Mining only
Down Syndrome	Down syndrome	Pubtator	25222269	Associate	★☆☆☆☆ Found in Text Mining only
Dyslipidemias	Dyslipidemias	Pubtator	35274685	Associate	★☆☆☆☆ Found in Text Mining only
Eczema	Eczema	Pubtator	22151743, 22192168	Associate	★☆☆☆☆ Found in Text Mining only
Eczema	Eczema	BEFREE	22192168		★☆☆☆☆ Found in Text Mining only
Endometrial Neoplasms	Endometrial neoplasm	Pubtator	35937391, 36199963	Associate	★☆☆☆☆ Found in Text Mining only
Endometrial Neoplasms	Endometrial neoplasm	Pubtator	39387602	Inhibit	★☆☆☆☆ Found in Text Mining only
Eosinophilia	Eosinophilia	BEFREE	11290768		★☆☆☆☆ Found in Text Mining only
Eosinophilia	Eosinophilia	Pubtator	26047816	Associate	★☆☆☆☆ Found in Text Mining only
Esophageal carcinoma	Esophageal Carcinoma	BEFREE	20181455		★☆☆☆☆ Found in Text Mining only
Esophageal Neoplasms	Esophageal neoplasm	Pubtator	15052669	Associate	★☆☆☆☆ Found in Text Mining only
Esophageal Neoplasms	Esophagus Neoplasm	BEFREE	20181455		★☆☆☆☆ Found in Text Mining only
Esophageal Squamous Cell Carcinoma	Esophageal squamous cell carcinoma	Pubtator	20825428	Inhibit	★☆☆☆☆ Found in Text Mining only
Fabry Disease	Fabry disease	BEFREE	27733175		★☆☆☆☆ Found in Text Mining only
Fabry Disease	Fabry disease	Pubtator	27733175	Stimulate	★☆☆☆☆ Found in Text Mining only
Familial multiple trichoepitheliomata	Multiple Trichoepithelioma	BEFREE	31646078		★☆☆☆☆ Found in Text Mining only
Focal glomerulosclerosis	Glomerulosclerosis	BEFREE	15888021, 24089165		★☆☆☆☆ Found in Text Mining only
Gastric Adenocarcinoma	Gastric Cancer	BEFREE	30628844		★☆☆☆☆ Found in Text Mining only
Gastrointestinal Neoplasms	Gastrointestinal neoplasm	Pubtator	29999557	Associate	★☆☆☆☆ Found in Text Mining only
Giant Cell Arteritis	Giant cell arteritis	Pubtator	31379838	Inhibit	★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	BEFREE	14603470, 24408016		★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	Pubtator	19688792	Associate	★☆☆☆☆ Found in Text Mining only
Glomerulonephritis IGA	Iga nephropathy	Pubtator	14871408	Associate	★☆☆☆☆ Found in Text Mining only
Glomerulosclerosis Focal Segmental	Focal segmental glomerulosclerosis	Pubtator	24089165, 25239302, 30777550	Associate	★☆☆☆☆ Found in Text Mining only
Graft vs Host Disease	Graft-versus-host disease	Pubtator	16982336, 23006339	Associate	★☆☆☆☆ Found in Text Mining only
Graft-vs-Host Disease	Graft-Vs-Host Disease	BEFREE	28414296, 30622541, 31846439		★☆☆☆☆ Found in Text Mining only
Granulomatosis with Polyangiitis	Granulomatosis with polyangiitis	Pubtator	11737598, 9764612	Associate	★☆☆☆☆ Found in Text Mining only
Graves Disease	Graves disease	Pubtator	12028565	Associate	★☆☆☆☆ Found in Text Mining only
Graves Disease	Graves Disease	BEFREE	16220002		★☆☆☆☆ Found in Text Mining only
Guillain-Barre Syndrome	Guillain-Barre Syndrome	BEFREE	10945811		★☆☆☆☆ Found in Text Mining only
Hashimoto Disease	Hashimoto Disease	BEFREE	31755324		★☆☆☆☆ Found in Text Mining only
Hepatitis Autoimmune	Autoimmune hepatitis	Pubtator	16688797, 26986756	Inhibit	★☆☆☆☆ Found in Text Mining only
Hepatitis B	Hepatitis b	Pubtator	17659054	Associate	★☆☆☆☆ Found in Text Mining only
Hepatitis C	Hepatitis c	Pubtator	18336742	Stimulate	★☆☆☆☆ Found in Text Mining only
Hodgkin Disease	Hodgkin Disease	BEFREE	10089910, 22267549		★☆☆☆☆ Found in Text Mining only
Hodgkin Disease	Hodgkin disease	Pubtator	10971392, 18400362, 9365164	Associate	★☆☆☆☆ Found in Text Mining only
Hyper-IgM Immunodeficiency Syndrome, Type 1	Hyper-IgM Immunodeficiency Syndrome	BEFREE	22154528		★☆☆☆☆ Found in Text Mining only
Hypertension Portal	Portal hypertension	Pubtator	34930041	Stimulate	★☆☆☆☆ Found in Text Mining only
Hypothyroidism	Hypothyroidism	GWASCAT_DG	30595370		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hypoxia	Hypoxia	Pubtator	34456926	Inhibit	★☆☆☆☆ Found in Text Mining only
Idiopathic Inflammatory Myopathies	Inflammatory Myopathy	BEFREE	22964787		★☆☆☆☆ Found in Text Mining only
Idiopathic Nephrotic Syndrome	Nephrotic Syndrome	BEFREE	28210837, 29360807		★☆☆☆☆ Found in Text Mining only
Idiopathic Pulmonary Fibrosis	Idiopathic pulmonary fibrosis	Pubtator	10678620, 22037258	Associate	★☆☆☆☆ Found in Text Mining only
IGA Glomerulonephritis	Glomerulonephritis	BEFREE	14871408		★☆☆☆☆ Found in Text Mining only
IGA Glomerulonephritis	Glomerulonephritis	LHGDN	14871408		★☆☆☆☆ Found in Text Mining only
Immune System Diseases	Immune system disease	Pubtator	15730400	Associate	★☆☆☆☆ Found in Text Mining only
Infertility	Infertility	Pubtator	18828896	Stimulate	★☆☆☆☆ Found in Text Mining only
Inflammatory Bowel Diseases	Inflammatory bowel disease	Pubtator	21903765, 26706980, 9353156	Associate	★☆☆☆☆ Found in Text Mining only
Inflammatory Bowel Diseases	Inflammatory Bowel Disease	BEFREE	26706980		★☆☆☆☆ Found in Text Mining only
Irritable Bowel Syndrome	Irritable Bowel Syndrome	BEFREE	31576093		★☆☆☆☆ Found in Text Mining only
Kaposi Sarcoma	Kaposi Sarcoma	BEFREE	10370381		★☆☆☆☆ Found in Text Mining only
Kidney Diseases	Kidney disease	Pubtator	14871408, 25017621, 26701979, 27733175, 34153873	Associate	★☆☆☆☆ Found in Text Mining only
Kidney Diseases	Kidney Disease	BEFREE	29722117, 30470792		★☆☆☆☆ Found in Text Mining only
Kidney Failure Chronic	Kidney failure	Pubtator	30499177, 34899727	Associate	★☆☆☆☆ Found in Text Mining only
Kidney Failure, Acute	Kidney Failure	BEFREE	30672713		★☆☆☆☆ Found in Text Mining only
Kidney Failure, Chronic	Kidney Failure	BEFREE	30499177		★☆☆☆☆ Found in Text Mining only
Laryngeal Neoplasms	Laryngeal neoplasm	Pubtator	16001164	Associate	★☆☆☆☆ Found in Text Mining only
Leprosy	Leprosy	Pubtator	9472661	Inhibit	★☆☆☆☆ Found in Text Mining only
Leprosy Lepromatous	Leprosy	Pubtator	9472661	Inhibit	★☆☆☆☆ Found in Text Mining only
Leukemia	Leukemia	Pubtator	10552958, 2040616, 27708227, 36613907, 9716596	Associate	★☆☆☆☆ Found in Text Mining only
leukemia	Leukemia	BEFREE	10609780, 11378266, 12176885, 12850480, 30482760, 9716596		★☆☆☆☆ Found in Text Mining only
Leukemia	Leukemia	Pubtator	15699173, 25936433	Stimulate	★☆☆☆☆ Found in Text Mining only
Leukemia	Leukemia	Pubtator	19734418	Inhibit	★☆☆☆☆ Found in Text Mining only
Leukemia Myeloid Acute	Myeloid leukemia	Pubtator	10942373, 11342441, 11459169, 11823047, 14662338, 15098140, 15585413, 25795133, 30500073, 9485189, 9716596	Associate	★☆☆☆☆ Found in Text Mining only
Leukemia Myelomonocytic Chronic	Myelomonocytic leukemia	Pubtator	10554809	Associate	★☆☆☆☆ Found in Text Mining only
Leukemia, Myelocytic, Acute	Leukemia	BEFREE	10516763, 10942373, 11090069, 12200676, 12580958, 15585413, 15627212, 19388935, 19711075, 27388616, 30482760, 9485189		★☆☆☆☆ Found in Text Mining only
Lip and Oral Cavity Carcinoma	Lip and Oral Cavity Carcinoma	BEFREE	28454394		★☆☆☆☆ Found in Text Mining only
Lipoid nephrosis	Lipoid Nephrosis	BEFREE	23689904, 24089165, 28210837, 29492674, 29507273, 30083478, 30470792		★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	12508355, 14695768, 16521215, 31235485		★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	LHGDN	15254713, 15377288		★☆☆☆☆ Found in Text Mining only
Liver Cirrhosis Biliary	Liver cirrhosis	Pubtator	23000144, 25690649, 28425483	Associate	★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung neoplasms	Pubtator	11267941, 35254478	Associate	★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung neoplasms	Pubtator	31552680	Inhibit	★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung neoplasms	Pubtator	34907653	Stimulate	★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus	Lupus Erythematosus	BEFREE	21978690		★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus Systemic	Systemic lupus erythematosus	Pubtator	10023862	Inhibit	★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus Systemic	Systemic lupus erythematosus	Pubtator	16879242, 17868260, 8698875	Stimulate	★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus Systemic	Systemic lupus erythematosus	Pubtator	17083624, 17257224, 20067533, 20653937, 32576231, 7512010	Associate	★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus, Discoid	Lupus Erythematosus	BEFREE	21978690		★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus, Systemic	Lupus Erythematosus	BEFREE	11196673, 20067533, 21978690, 25862617, 28631301		★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus, Systemic	Lupus Erythematosus	GWASCAT_DG	23273568, 25862617		★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus, Systemic	Lupus Erythematosus	GWASDB_DG	23273568		★☆☆☆☆ Found in Text Mining only
Lupus Nephritis	Lupus nephritis	Pubtator	16879242	Stimulate	★☆☆☆☆ Found in Text Mining only
Lupus Nephritis	Lupus Nephritis	BEFREE	26440060, 28631301, 30928350		★☆☆☆☆ Found in Text Mining only
Lupus Vulgaris	Lupus Vulgaris	BEFREE	21978690		★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic metastasis	Pubtator	25992611, 34907653	Associate	★☆☆☆☆ Found in Text Mining only
Lymphoma	Lymphoma	BEFREE	12874008, 19509224, 24523507, 30040869		★☆☆☆☆ Found in Text Mining only
Lymphoma	Lymphoma	Pubtator	2040616	Associate	★☆☆☆☆ Found in Text Mining only
Lymphoma Follicular	Lymphoma	Pubtator	22076940, 9373240	Associate	★☆☆☆☆ Found in Text Mining only
Lymphoma, T-Cell, Cutaneous	Lymphoma	BEFREE	24523507		★☆☆☆☆ Found in Text Mining only
Macular dystrophy, corneal type 1	Macular corneal dystrophy	BEFREE	23262434, 23689904, 28210837, 29492674, 29507273, 29722117, 30083478, 30470792		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	11477456, 15365776, 21394107, 24080446, 26881506, 30411299		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of esophagus	Esophagus Neoplasm	BEFREE	20181455		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of liver	Liver Cancer	BEFREE	30551483		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of lung	Lung Cancer	BEFREE	11267941, 11422893		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of mouth	Malignant neoplasm of mouth	BEFREE	28454394		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of ovary	Ovarian cancer	BEFREE	10359208, 10606960, 11860540, 14715418		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of pancreas	Pancreatic cancer	BEFREE	26423423, 28856392		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of stomach	Stomach Neoplasms	BEFREE	15201958, 15492821, 15522320, 24981235		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of urinary bladder	Urinary bladder cancer	BEFREE	10209504		★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	11477456, 12048160, 12874008, 15492821, 20181455, 22267549, 26785143, 28643244, 29122838, 31628526		★☆☆☆☆ Found in Text Mining only
Malignant tumor of cervix	Cervical Tumor	BEFREE	9159336		★☆☆☆☆ Found in Text Mining only
Malignant tumor of colon	Colonic Neoplasms	BEFREE	12100028, 31072360		★☆☆☆☆ Found in Text Mining only
Mastocytosis Cutaneous	Mastocytosis	Pubtator	24459815	Associate	★☆☆☆☆ Found in Text Mining only
Melanoma	Melanoma	Pubtator	10477389, 10823418, 11459172, 15937544, 18221542, 21903207, 37614091, 9652756	Associate	★☆☆☆☆ Found in Text Mining only
melanoma	Melanoma	BEFREE	11459172, 12709016, 15937544, 17453965, 29704887, 31161312, 7589065, 8652275, 8725884, 9551360, 9690457		★☆☆☆☆ Found in Text Mining only
melanoma	Melanoma	LHGDN	12569387		★☆☆☆☆ Found in Text Mining only
Miscarriage	Miscarriage	BEFREE	21481059		★☆☆☆☆ Found in Text Mining only
Mucositis	Mucositis	Pubtator	22156200	Associate	★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Multiple myeloma	Pubtator	10029575, 16001164, 17309825, 17311991, 29981782	Associate	★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Multiple myeloma	BEFREE	10384156, 11477456, 11698282, 14692533, 16001164, 29981782		★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Multiple myeloma	Pubtator	10942368, 12070032	Inhibit	★☆☆☆☆ Found in Text Mining only
Multiple Sclerosis	Multiple Sclerosis	BEFREE	10742561, 26531698		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Multiple Sclerosis	Multiple Sclerosis	LHGDN	12100477		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Multiple Sclerosis	Multiple sclerosis	Pubtator	12100477, 15544628, 24472094	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Multiple Sclerosis	Multiple sclerosis	Pubtator	25480859, 7500044, 9169496	Stimulate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Myelodysplastic Syndromes	Myelodysplastic syndrome	Pubtator	10606893, 23714180	Inhibit	★☆☆☆☆ Found in Text Mining only
MYELOPROLIFERATIVE DISORDER, CHRONIC, WITH EOSINOPHILIA	Myeloproliferative Disorder with Eosinophilia	BEFREE	29847991		★☆☆☆☆ Found in Text Mining only
Myocardial Infarction	Myocardial infarction	Pubtator	29885276	Associate	★☆☆☆☆ Found in Text Mining only
Myositis	Myositis	Pubtator	10433938	Associate	★☆☆☆☆ Found in Text Mining only
Myositis Inclusion Body	Myositis	Pubtator	10433938	Associate	★☆☆☆☆ Found in Text Mining only
Nasopharyngeal carcinoma	Nasopharyngeal Carcinoma	BEFREE	17524139, 18999931		★☆☆☆☆ Found in Text Mining only
Nasopharyngeal Carcinoma	Nasopharyngeal carcinoma	Pubtator	17524139	Associate	★☆☆☆☆ Found in Text Mining only
Neck Neoplasms	Neck Neoplasms	BEFREE	26785143		★☆☆☆☆ Found in Text Mining only
Necrosis	Necrosis	Pubtator	12905492	Inhibit	★☆☆☆☆ Found in Text Mining only
Necrosis	Necrosis	Pubtator	16108813	Stimulate	★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	10359214, 10370381, 10374432, 10477389, 10854153, 10928114, 11122109, 11131151, 11175312, 11228533, 11267941, 11571536, 11956426, 12874008, 14695768, 14715418, 15492821, 16424052, 16517754, 16525479, 16841083, 17453965, 19788391, 20718755, 21903207, 23382860, 23671644, 25374234, 26423423, 28291636, 28454394, 28460461, 28782555, 28856392, 29122838, 29487385, 29690614, 30061941, 30090893, 30123257, 30521746, 30930997, 9375572, 9380730, 9533541, 9610915		★☆☆☆☆ Found in Text Mining only
Nephroblastoma	Nephroblastoma	BEFREE	27548033		★☆☆☆☆ Found in Text Mining only
Nephrosis Lipoid	Nephrotic syndrome	Pubtator	19056875, 23689904	Stimulate	★☆☆☆☆ Found in Text Mining only
Nephrosis Lipoid	Nephrotic syndrome	Pubtator	25017621, 25239302, 28150736, 29492674	Associate	★☆☆☆☆ Found in Text Mining only
Nephrotic Syndrome	Nephrotic syndrome	Pubtator	19056875, 24089165	Associate	★☆☆☆☆ Found in Text Mining only
Nephrotic Syndrome	Nephrotic Syndrome	BEFREE	23262434, 24089165, 28951877, 29022109, 29492674, 29507273, 29569191, 30470792		★☆☆☆☆ Found in Text Mining only
Nephrotic Syndrome, Minimal Change	Nephrotic Syndrome	BEFREE	28210837, 29360807		★☆☆☆☆ Found in Text Mining only
Nervous System Diseases	Nervous system disease	Pubtator	35132656	Associate	★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	Pubtator	12771917	Associate	★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	BEFREE	14555710, 18802064, 20718755, 28687069		★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	Pubtator	28687069	Inhibit	★☆☆☆☆ Found in Text Mining only
Neuropathy	Neuropathy	BEFREE	10908195		★☆☆☆☆ Found in Text Mining only
Non-Small Cell Lung Carcinoma	Lung carcinoma	BEFREE	11267941, 11551413		★☆☆☆☆ Found in Text Mining only
Osteoarthritis	Osteoarthritis	Pubtator	34899727	Associate	★☆☆☆☆ Found in Text Mining only
Osteoporosis	Osteoporosis	BEFREE	28466138		★☆☆☆☆ Found in Text Mining only
Ovarian Carcinoma	Ovarian Carcinoma	BEFREE	10359208, 10606960, 14715418		★☆☆☆☆ Found in Text Mining only
ovarian neoplasm	Ovarian neoplasm	BEFREE	11860540		★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Ovarian neoplasm	Pubtator	14715418, 23382860, 37124547	Associate	★☆☆☆☆ Found in Text Mining only
Pancreatic carcinoma	Pancreatic carcinoma	BEFREE	26423423, 28856392		★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasms	Pancreatic neoplasm	Pubtator	23029049, 31483844	Associate	★☆☆☆☆ Found in Text Mining only
Paraparesis Tropical Spastic	Tropical spastic paraparesis	Pubtator	24472094	Associate	★☆☆☆☆ Found in Text Mining only
Periodontal Diseases	Periodontal Diseases	BEFREE	15664948		★☆☆☆☆ Found in Text Mining only
Peritoneal Neoplasms	Peritoneal neoplasm	Pubtator	10606960	Associate	★☆☆☆☆ Found in Text Mining only
Peritoneal Neoplasms	Peritoneal neoplasm	Pubtator	30226638	Inhibit	★☆☆☆☆ Found in Text Mining only
Pituitary Neoplasms	Pituitary neoplasm	Pubtator	34745002	Associate	★☆☆☆☆ Found in Text Mining only
Polycythemia Vera	Polycythemia vera	Pubtator	36175590	Inhibit	★☆☆☆☆ Found in Text Mining only
Polymyositis	Polymyositis	BEFREE	12409186		★☆☆☆☆ Found in Text Mining only
Pre B-cell acute lymphoblastic leukemia	B-cell Lymphoma	BEFREE	26444983		★☆☆☆☆ Found in Text Mining only
Precursor B-cell lymphoblastic leukemia	Lymphoblastic Leukemia	BEFREE	26444983		★☆☆☆☆ Found in Text Mining only
Precursor Cell Lymphoblastic Leukemia Lymphoma	Lymphoblastic Leukemia	BEFREE	10942373		★☆☆☆☆ Found in Text Mining only
Primary biliary cirrhosis	Biliary Cirrhosis	CTD_human_DG	21399635		★☆☆☆☆ Found in Text Mining only
Primary biliary cirrhosis	Biliary Cirrhosis	BEFREE	23000144, 30643196, 31027870		★☆☆☆☆ Found in Text Mining only
Proteinuria	Proteinuria	Pubtator	23006339, 24089165, 25239302, 28150736, 30777550, 35507150	Associate	★☆☆☆☆ Found in Text Mining only
Pulmonary Disease Chronic Obstructive	Chronic obstructive pulmonary disease	Pubtator	15802338	Inhibit	★☆☆☆☆ Found in Text Mining only
Pulmonary Disease Chronic Obstructive	Chronic obstructive pulmonary disease	Pubtator	19729666, 31320835	Associate	★☆☆☆☆ Found in Text Mining only
Pulmonary Disease Chronic Obstructive	Chronic obstructive pulmonary disease	Pubtator	26191210	Stimulate	★☆☆☆☆ Found in Text Mining only
Rectal polyp	Rectal Polyp	BEFREE	29277562		★☆☆☆☆ Found in Text Mining only
Renal Cell Carcinoma	Renal Carcinoma	BEFREE	10854153, 11175312, 25242680, 7545143		★☆☆☆☆ Found in Text Mining only
Respiratory Distress Syndrome, Newborn	Congenital alveolar dysplasia	BEFREE	30243953		★☆☆☆☆ Found in Text Mining only
Retinoschisis	Retinoschisis	Pubtator	33601057	Associate	★☆☆☆☆ Found in Text Mining only
Rheumatic Chorea	Rheumatic Chorea	BEFREE	20080141		★☆☆☆☆ Found in Text Mining only
Rheumatoid Arthritis	Rheumatoid arthritis	BEFREE	11196673, 17142787, 22917707, 29922065		★☆☆☆☆ Found in Text Mining only
Rheumatoid Arthritis	Rheumatoid arthritis	LHGDN	17323353		★☆☆☆☆ Found in Text Mining only
Sarcoidosis	Sarcoidosis	BEFREE	15942292		★☆☆☆☆ Found in Text Mining only
Sarcoidosis	Sarcoidosis	Pubtator	17626112, 7586698	Associate	★☆☆☆☆ Found in Text Mining only
Scleroderma Systemic	Systemic sclerosis	Pubtator	15188368	Stimulate	★☆☆☆☆ Found in Text Mining only
Secondary Biliary Cholangitis	Biliary Cholangitis	CTD_human_DG	21399635		★☆☆☆☆ Found in Text Mining only
Septicemia	Septicemia	BEFREE	19672303, 29891541, 30672713		★☆☆☆☆ Found in Text Mining only
Situs Inversus	Situs Inversus	BEFREE	30196302		★☆☆☆☆ Found in Text Mining only
Sjogren's Syndrome	Sjogren syndrome	Pubtator	10025916	Stimulate	★☆☆☆☆ Found in Text Mining only
Sjogren's Syndrome	Sjogren syndrome	Pubtator	32208441, 34594326	Associate	★☆☆☆☆ Found in Text Mining only
Skin Diseases	Skin disease	Pubtator	15544628	Associate	★☆☆☆☆ Found in Text Mining only
Skin Diseases	Skin disease	Pubtator	7523532	Stimulate	★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma	Carcinoma	LHGDN	17201120		★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma	Carcinoma	BEFREE	31159869, 31796082		★☆☆☆☆ Found in Text Mining only
Squamous Cell Carcinoma of Head and Neck	Squamous cell carcinoma	Pubtator	28052009, 32281488, 32548602, 9541571	Associate	★☆☆☆☆ Found in Text Mining only
Squamous Cell Carcinoma of Head and Neck	Squamous cell carcinoma	Pubtator	36983005	Stimulate	★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of tongue	Tongue carcinoma	BEFREE	31604589		★☆☆☆☆ Found in Text Mining only
Stable angina	Stable Angina	BEFREE	24107715		★☆☆☆☆ Found in Text Mining only
Stomach Carcinoma	Stomach Carcinoma	BEFREE	15201958, 15492821, 15522320, 24981235		★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	12800259, 32025206	Associate	★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach Neoplasms	LHGDN	15201958		★☆☆☆☆ Found in Text Mining only
Stroke	Stroke	Pubtator	34201498	Stimulate	★☆☆☆☆ Found in Text Mining only
TARSAL-CARPAL COALITION SYNDROME	Tarsal-Carpal Coalition Syndrome	BEFREE	10209504		★☆☆☆☆ Found in Text Mining only
Thrombocythemia Essential	Essential thrombocythemia	Pubtator	36175590	Inhibit	★☆☆☆☆ Found in Text Mining only
Thyroid associated opthalmopathies	Thyroid eye disease	BEFREE	20039900, 20884055		★☆☆☆☆ Found in Text Mining only
Thyroiditis	Thyroiditis	LHGDN	11936473		★☆☆☆☆ Found in Text Mining only
Triglyceride storage disease with ichthyosis	Triglyceride Storage Disease With Ichthyosis	BEFREE	29075103		★☆☆☆☆ Found in Text Mining only
Turcot syndrome	Turcot syndrome	Pubtator	26496037	Stimulate	★☆☆☆☆ Found in Text Mining only
Turcot syndrome (disorder)	Turcot syndrome	BEFREE	26496037		★☆☆☆☆ Found in Text Mining only
Ulcerative Colitis	Ulcerative colitis	LHGDN	15628695		★☆☆☆☆ Found in Text Mining only
Ulcerative Colitis	Ulcerative colitis	BEFREE	24347371, 24944468, 25595911, 26706980		★☆☆☆☆ Found in Text Mining only
Uterine Cervical Dysplasia	Uterine disease	Pubtator	23521696	Inhibit	★☆☆☆☆ Found in Text Mining only
Uveal melanoma	Uveal melanoma	Pubtator	12709016, 19557412	Associate	★☆☆☆☆ Found in Text Mining only
Uveal melanoma	Uveal Melanoma	BEFREE	30956760		★☆☆☆☆ Found in Text Mining only
Ventricular Dysfunction Left	Ventricular dysfunction	Pubtator	40088950	Associate	★☆☆☆☆ Found in Text Mining only
Ventricular Septal Defects	Ventricular septal defect	BEFREE	31440271		★☆☆☆☆ Found in Text Mining only
Vitiligo	Vitiligo	Pubtator	15937544	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Vitiligo	Vitiligo	CTD_human_DG	22561518		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
X-linked agammaglobulinemia	Agammaglobulinemia, X-Linked	BEFREE	24612681		★☆☆☆☆ Found in Text Mining only