TMPRSS11D (transmembrane serine protease 11D)

Gene

• Entrez ID: 9407
• Gene name: Transmembrane serine protease 11D
• Gene symbol: TMPRSS11D
• Synonyms (NCBI Gene): ASP, HAT
• Chromosome: 4
• Chromosome location: 4q13.2
• Summary: This gene encodes a trypsin-like serine protease released from the submucosal serous glands onto mucous membrane. It is a type II integral membrane protein and has 29-38% identity in the sequence of the catalytic region with human hepsin, enteropeptidase,

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT017295	hsa-miR-335-5p	Microarray	18185580
MIRT1440952	hsa-miR-101	CLIP-seq
MIRT1440953	hsa-miR-1253	CLIP-seq
MIRT1440954	hsa-miR-1298	CLIP-seq
MIRT1440955	hsa-miR-1912	CLIP-seq
MIRT1440956	hsa-miR-3613-3p	CLIP-seq
MIRT1440957	hsa-miR-3667-5p	CLIP-seq
MIRT1440958	hsa-miR-371b-5p	CLIP-seq
MIRT1440959	hsa-miR-3919	CLIP-seq
MIRT1440960	hsa-miR-3941	CLIP-seq
MIRT1440961	hsa-miR-4276	CLIP-seq
MIRT1440962	hsa-miR-4282	CLIP-seq
MIRT1440963	hsa-miR-466	CLIP-seq
MIRT1440964	hsa-miR-4672	CLIP-seq
MIRT1440965	hsa-miR-4691-3p	CLIP-seq
MIRT1440966	hsa-miR-4795-3p	CLIP-seq
MIRT1440967	hsa-miR-507	CLIP-seq
MIRT1440968	hsa-miR-513a-3p	CLIP-seq
MIRT1440969	hsa-miR-557	CLIP-seq
MIRT1440970	hsa-miR-574-3p	CLIP-seq
MIRT1440971	hsa-miR-590-3p	CLIP-seq
MIRT1440972	hsa-miR-944	CLIP-seq
MIRT2132021	hsa-miR-208a	CLIP-seq
MIRT2132022	hsa-miR-208b	CLIP-seq
MIRT2132023	hsa-miR-23a	CLIP-seq
MIRT2132024	hsa-miR-23b	CLIP-seq
MIRT2132025	hsa-miR-23c	CLIP-seq
MIRT2132026	hsa-miR-3617	CLIP-seq
MIRT2132027	hsa-miR-3658	CLIP-seq
MIRT2132028	hsa-miR-4269	CLIP-seq
MIRT2132029	hsa-miR-4709-5p	CLIP-seq
MIRT2132030	hsa-miR-4775	CLIP-seq
MIRT2132031	hsa-miR-499-5p	CLIP-seq
MIRT1440971	hsa-miR-590-3p	CLIP-seq
MIRT2132032	hsa-miR-641	CLIP-seq
MIRT2353157	hsa-miR-337-3p	CLIP-seq
MIRT2353158	hsa-miR-3685	CLIP-seq
MIRT2353159	hsa-miR-3688-3p	CLIP-seq
MIRT2353160	hsa-miR-384	CLIP-seq
MIRT2353161	hsa-miR-4504	CLIP-seq
MIRT2353162	hsa-miR-4652-3p	CLIP-seq
MIRT2353163	hsa-miR-561	CLIP-seq
MIRT2353164	hsa-miR-671-5p	CLIP-seq

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0004252	Function	Serine-type endopeptidase activity	IEA
GO:0005515	Function	Protein binding	IPI	32296183
GO:0005576	Component	Extracellular region	IEA
GO:0005576	Component	Extracellular region	TAS	9565616
GO:0005886	Component	Plasma membrane	IBA
GO:0005886	Component	Plasma membrane	IEA
GO:0005886	Component	Plasma membrane	TAS	9565616
GO:0006508	Process	Proteolysis	IDA	24227843
GO:0006508	Process	Proteolysis	IEA
GO:0007585	Process	Respiratory gaseous exchange by respiratory system	TAS	9565616
GO:0008233	Function	Peptidase activity	IEA
GO:0008233	Function	Peptidase activity	TAS	9565616
GO:0008236	Function	Serine-type peptidase activity	IBA
GO:0008236	Function	Serine-type peptidase activity	IEA
GO:0016020	Component	Membrane	IEA
GO:0016787	Function	Hydrolase activity	IEA
GO:0070062	Component	Extracellular exosome	HDA	19056867

Other IDs

• MIM: 605369
• HGNC: 24059
• e!Ensembl: ENSG00000153802

Protein

• UniProt ID: O60235
• Protein name: Transmembrane protease serine 11D (EC 3.4.21.-) (Airway trypsin-like protease) [Cleaved into: Transmembrane protease serine 11D non-catalytic chain; Transmembrane protease serine 11D catalytic chain]
• Protein function: May play some biological role in the host defense system on the mucous membrane independently of or in cooperation with other substances in airway mucous or bronchial secretions. Plays a role in the proteolytic processing of ACE2. Proteolyticall
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF01390	SEA	48 → 152	SEA domain	Family
  PF00089	Trypsin	187 → 412	Trypsin	Domain

• Tissue specificity: TISSUE SPECIFICITY: Located in the cells of the submucosal serous glands of the bronchi and trachea.
• Sequence:

  MYRPARVTSTSRFLNPYVVCFIVVAGVVILAVTIALLVYFLAFDQKSYFYRSSFQLLNVE
  YNSQLNSPATQEYRTLSGRIESLITKTFKESNLRNQFIRAHVAKLRQDGSGVRADVVMKF
  QFTRNNNGASMKSRIESVLRQMLNNSGNLEINPSTEITSLTDQAAANWLINECGAGPDLI
  TLSEQRILGGTEAEEGSWPWQVSLRLNNAHHCGGSLINNMWILTAAHCFRSNSNPRDWIA
  TSGISTTFPKLRMRVRNILIHNNYKSATHENDIALVRLENSVTFTKDIHSVCLPAATQNI
  PPGSTAYVTGWGAQEYAGHTVPELRQGQVRIISNDVCNAPHSYNGAILSGMLCAGVPQGG
  VDACQGDSGGPLVQEDSRRLWFIVGIVSWGDQCGLPDKPGVYTRVTAYLDWIRQQTGI

• Sequence length: 418

Pathways

KEGG:

Influenza A

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
Malignant tumor of esophagus	Likely benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
VENOUS THROMBOEMBOLISM	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Anaphylaxis	Anaphylaxis	Pubtator	38287122	Associate	★☆☆☆☆ Found in Text Mining only
Anaplasia	Anaplasia	BEFREE	26297835		★☆☆☆☆ Found in Text Mining only
Brain Diseases	Brain disease	Pubtator	32911427	Associate	★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	28431939		★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	31900196	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma	Carcinoma	BEFREE	26297835		★☆☆☆☆ Found in Text Mining only
Carcinoma Squamous Cell	Squamous cell carcinoma	Pubtator	26297835	Inhibit	★☆☆☆☆ Found in Text Mining only
Carcinoma Squamous Cell	Squamous cell carcinoma	Pubtator	28086212	Associate	★☆☆☆☆ Found in Text Mining only
Cardiovascular Diseases	Cardiovascular disease	Pubtator	32970391	Associate	★☆☆☆☆ Found in Text Mining only
Childhood Acute Lymphoblastic Leukemia	Lymphoblastic Leukemia	BEFREE	22388726		★☆☆☆☆ Found in Text Mining only
Colon Carcinoma	Colon Carcinoma	BEFREE	28418886		★☆☆☆☆ Found in Text Mining only
Depressive Disorder	Major depressive disorder	Pubtator	32911427	Associate	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes mellitus	Pubtator	32970391	Associate	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Non-Insulin-Dependent	Diabetes Mellitus	BEFREE	29524189		★☆☆☆☆ Found in Text Mining only
Hypoglycemia	Hypoglycemia	BEFREE	29524189		★☆☆☆☆ Found in Text Mining only
Leukemia, Myelocytic, Acute	Leukemia	BEFREE	24258712, 27485472		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	28431939		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	BEFREE	23056207		★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	19787264, 30924641		★☆☆☆☆ Found in Text Mining only
Malignant tumor of colon	Colonic Neoplasms	BEFREE	28418886		★☆☆☆☆ Found in Text Mining only
Mastocytosis	Mastocytosis	Pubtator	38287122	Associate	★☆☆☆☆ Found in Text Mining only
Mouth Neoplasms	Mouth neoplasm	Pubtator	33402507	Associate	★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	28360947		★☆☆☆☆ Found in Text Mining only
Non-alcoholic Fatty Liver Disease	Non-Alcoholic Fatty Liver Disease	BEFREE	30473486		★☆☆☆☆ Found in Text Mining only
Non-Small Cell Lung Carcinoma	Lung carcinoma	BEFREE	28086212		★☆☆☆☆ Found in Text Mining only
Prostate carcinoma	Prostate cancer	BEFREE	23056207		★☆☆☆☆ Found in Text Mining only
Psoriasis vulgaris	Psoriasis vulgaris	BEFREE	15102084		★☆☆☆☆ Found in Text Mining only
Pulmonary Disease Chronic Obstructive	Chronic obstructive pulmonary disease	Pubtator	9565616	Associate	★☆☆☆☆ Found in Text Mining only
Pulmonary Eosinophilia	Pulmonary Eosinophilia	BEFREE	24355018		★☆☆☆☆ Found in Text Mining only
Pulmonary Fibrosis	Pulmonary Fibrosis	BEFREE	29122847		★☆☆☆☆ Found in Text Mining only
Respiration Disorders	Respiration Disorders	BEFREE	28235951		★☆☆☆☆ Found in Text Mining only
Rett Syndrome	Rett Syndrome	BEFREE	12566391		★☆☆☆☆ Found in Text Mining only
Rothmund-Thomson syndrome	Rothmund-Thomson Syndrome	BEFREE	12566391		★☆☆☆☆ Found in Text Mining only
Rubinstein-Taybi Syndrome	Rubinstein-Taybi Syndrome	BEFREE	27648933		★☆☆☆☆ Found in Text Mining only
Septicemia	Septicemia	BEFREE	30441816		★☆☆☆☆ Found in Text Mining only
Severe Acute Respiratory Syndrome	Severe Acute Respiratory Syndrome	BEFREE	24227843		★☆☆☆☆ Found in Text Mining only
Squamous Cell Carcinoma of Head and Neck	Squamous cell carcinoma	Pubtator	30431092	Associate	★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	19479822	Associate	★☆☆☆☆ Found in Text Mining only
T-Cell Lymphoma	T-Cell Lymphoma	BEFREE	2307541		★☆☆☆☆ Found in Text Mining only