Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Associated diseases
Entrez ID	9404
Gene name	Leupaxin
Gene symbol	LPXN
Synonyms (NCBI Gene)	LDPL
Chromosome	11
Chromosome location	11q12.1
Summary	The product encoded by this gene is preferentially expressed in hematopoietic cells and belongs to the paxillin protein family. Similar to other members of this focal-adhesion-associated adaptor-protein family, it has four leucine-rich LD-motifs in the N-

Show/Hide all (22)

miRTarBase ID	miRNA	Experiments	Reference
MIRT021415	hsa-miR-9-5p	Microarray	17612493
MIRT644474	hsa-miR-4668-3p	HITS-CLIP	23824327
MIRT644473	hsa-miR-877-3p	HITS-CLIP	23824327
MIRT644472	hsa-miR-138-1-3p	HITS-CLIP	23824327
MIRT644471	hsa-miR-4635	HITS-CLIP	23824327
MIRT644470	hsa-miR-7111-3p	HITS-CLIP	23824327
MIRT644469	hsa-miR-6780a-3p	HITS-CLIP	23824327
MIRT644468	hsa-miR-6881-3p	HITS-CLIP	23824327
MIRT644474	hsa-miR-4668-3p	HITS-CLIP	23824327
MIRT644473	hsa-miR-877-3p	HITS-CLIP	23824327
MIRT644472	hsa-miR-138-1-3p	HITS-CLIP	23824327
MIRT644471	hsa-miR-4635	HITS-CLIP	23824327
MIRT644470	hsa-miR-7111-3p	HITS-CLIP	23824327
MIRT644469	hsa-miR-6780a-3p	HITS-CLIP	23824327
MIRT644468	hsa-miR-6881-3p	HITS-CLIP	23824327
MIRT1117171	hsa-miR-34c-3p	CLIP-seq
MIRT1117172	hsa-miR-3647-3p	CLIP-seq
MIRT1117173	hsa-miR-4434	CLIP-seq
MIRT1117174	hsa-miR-4516	CLIP-seq
MIRT1117175	hsa-miR-4529-5p	CLIP-seq
MIRT1117176	hsa-miR-4531	CLIP-seq
MIRT1117177	hsa-miR-4694-3p	CLIP-seq

Show/Hide all (33)

GO ID	Ontology	Definition	Evidence	Reference
GO:0002102	Component	Podosome	IDA	12674328
GO:0002102	Component	Podosome	IEA
GO:0003712	Function	Transcription coregulator activity	IDA	18451096, 18497331
GO:0003712	Function	Transcription coregulator activity	IEA
GO:0005515	Function	Protein binding	IPI	17640867, 18451096, 18497331, 21900206, 23088713, 25416956, 28514442, 31515488, 32296183, 32814053, 33961781
GO:0005634	Component	Nucleus	IDA	18451096, 18497331
GO:0005634	Component	Nucleus	IEA
GO:0005737	Component	Cytoplasm	IDA	17640867, 18451096, 18497331
GO:0005737	Component	Cytoplasm	IEA
GO:0005829	Component	Cytosol	IDA
GO:0005886	Component	Plasma membrane	IDA	17640867
GO:0005886	Component	Plasma membrane	IEA
GO:0005925	Component	Focal adhesion	IDA	18451096, 18497331, 20543562
GO:0005925	Component	Focal adhesion	IEA
GO:0007155	Process	Cell adhesion	IEA
GO:0007155	Process	Cell adhesion	NAS	9565592
GO:0007162	Process	Negative regulation of cell adhesion	IDA	20543562
GO:0007165	Process	Signal transduction	TAS	9565592
GO:0007179	Process	Transforming growth factor beta receptor signaling pathway	IBA
GO:0016020	Component	Membrane	HDA	19946888
GO:0016020	Component	Membrane	IEA
GO:0016607	Component	Nuclear speck	IDA
GO:0033628	Process	Regulation of cell adhesion mediated by integrin	IEA
GO:0034446	Process	Substrate adhesion-dependent cell spreading	IBA
GO:0042995	Component	Cell projection	IEA
GO:0043542	Process	Endothelial cell migration	IBA
GO:0046872	Function	Metal ion binding	IEA
GO:0048471	Component	Perinuclear region of cytoplasm	IEA
GO:0050859	Process	Negative regulation of B cell receptor signaling pathway	IBA
GO:0050859	Process	Negative regulation of B cell receptor signaling pathway	IDA	17640867
GO:0050859	Process	Negative regulation of B cell receptor signaling pathway	IEA
GO:0065003	Process	Protein-containing complex assembly	TAS	9565592
GO:0070161	Component	Anchoring junction	IEA

MIM	HGNC	e!Ensembl
605390	14061	ENSG00000110031

O60711

Protein name

Leupaxin

Protein function

Transcriptional coactivator for androgen receptor (AR) and serum response factor (SRF). Contributes to the regulation of cell adhesion, spreading and cell migration and acts as a negative regulator in integrin-mediated cell adhesion events. Supp

PDB

1X3H , 4XEF , 4XEK , 4XEV

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00412	LIM	152 → 207	LIM domain	Domain
PF00412	LIM	211 → 266	LIM domain	Domain
PF00412	LIM	270 → 325	LIM domain	Domain
PF00412	LIM	329 → 384	LIM domain	Domain

Tissue specificity

TISSUE SPECIFICITY: Macrophages, monocytes and osteoclasts (at protein level). Strongly expressed in cells and tissues of hematopoietic origin. Highest expression in lymphoid tissues such as spleen, lymph node, thymus and appendix and in the vascular smoo

Sequence

MEELDALLEELERSTLQDSDEYSNPAPLPLDQHSRKETNLDETSEILSIQDNTSPLPAQL
VYTTNIQELNVYSEAQEPKESPPPSKTSAAAQLDELMAHLTEMQAKVAVRADAGKKHLPD
KQDHKASLDSMLGGLEQELQDLGIATVPKGHCASCQKPIAGKVIHALGQSWHPEHFVCTH
CKEEIGSSPFFERSGLAYCPNDYHQLFSPRCAYCAAPILDKVLTAMNQTWHPEHFFCSHC
GEVFGAEGFHEKDKKPYCRKDFLAMFSPKCGGCNRPVLENYLSAMDTVWHPECFVCGDCF
TSFSTGSFFELDGRPFCELHYHHRRGTLCHGCGQPITGRCISAMGYKFHPEHFVCAFCLT
QLSKGIFREQNDKTYCQPCFNKLFPL

Sequence length

386

Interactions

View interactions

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (9)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
ALZHEIMER DISEASE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ANKYLOSING SPONDYLITIS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CROHN'S DISEASE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
INFLAMMATORY BOWEL DISEASE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LIVER CIRRHOSIS, EXPERIMENTAL	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OPEN-ANGLE GLAUCOMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PSORIASIS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SCLEROSING CHOLANGITIS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ULCERATIVE COLITIS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (32)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Adenocarcinoma	Adenocarcinoma	BEFREE	19701244		★★★★★ ★☆☆☆☆ Found in Text Mining only
Bladder Neoplasm	Bladder Neoplasm	BEFREE	29975926		★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	25955236		★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	26866573	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma	Carcinoma	BEFREE	25955236		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	26361959	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma of bladder	Bladder carcinoma	BEFREE	29975926		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma of lung	Lung carcinoma	BEFREE	25955236		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ductal Carcinoma	Ductal Carcinoma	BEFREE	25955236		★★★★★ ★☆☆☆☆ Found in Text Mining only
Endometrial Carcinoma	Endometrial carcinoma	BEFREE	25955236		★★★★★ ★☆☆☆☆ Found in Text Mining only
Endometrial Neoplasms	Endometrial neoplasm	Pubtator	34763648	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Inflammatory Bowel Diseases	Inflammatory Bowel Disease	GWASCAT_DG	23128233		★★★★★ ★☆☆☆☆ Found in Text Mining only
Inflammatory Bowel Diseases	Inflammatory Bowel Disease	GWASDB_DG	23128233		★★★★★ ★☆☆☆☆ Found in Text Mining only
leukemia	Leukemia	BEFREE	26542893		★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia, Myelocytic, Acute	Leukemia	BEFREE	19760607, 26542893		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	26361959		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphoma	Lymphoma	BEFREE	15914563		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphoma	Lymphoma	Pubtator	23349640	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	25955236		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of endometrium	Endometrial Cancer	BEFREE	25955236		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of lung	Lung Cancer	BEFREE	25955236		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	BEFREE	17329398, 26079947		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of urinary bladder	Urinary bladder cancer	BEFREE	29975926		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	25955236, 29975926		★★★★★ ★☆☆☆☆ Found in Text Mining only
Metastatic Prostate Carcinoma	Metastatic Prostate Carcinoma	BEFREE	17329398		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	29975926		★★★★★ ★☆☆☆☆ Found in Text Mining only
Noninfiltrating Intraductal Carcinoma	Ductal carcinoma	BEFREE	25955236		★★★★★ ★☆☆☆☆ Found in Text Mining only
Periodontitis	Periodontitis	Pubtator	34732256	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostate carcinoma	Prostate cancer	BEFREE	17329398, 19701244, 26079947		★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic Neoplasms	LHGDN	17329398		★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	17329398, 18451096, 26079947	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Urinary Bladder Neoplasms	Urinary bladder neoplasms	Pubtator	29975926	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only

LPXN (leupaxin)