Gene Gene information from NCBI Gene database.
Entrez ID 9402
Gene name GRB2 related adaptor protein 2
Gene symbol GRAP2
Synonyms (NCBI Gene)
GADSGRAP-2GRB2LGRBLGGRIDGRPLGrbXGrf40MonaP38
Chromosome 22
Chromosome location 22q13.1
Summary This gene encodes a member of the GRB2/Sem5/Drk family. This member is an adaptor-like protein involved in leukocyte-specific protein-tyrosine kinase signaling. Like its related family member, GRB2-related adaptor protein (GRAP), this protein contains an
miRNA miRNA information provided by mirtarbase database.
85
miRTarBase ID miRNA Experiments Reference
MIRT725476 hsa-miR-504-5p HITS-CLIP 19536157
MIRT725475 hsa-miR-3681-5p HITS-CLIP 19536157
MIRT725474 hsa-miR-6849-5p HITS-CLIP 19536157
MIRT725472 hsa-miR-3620-3p HITS-CLIP 19536157
MIRT725473 hsa-miR-3622a-3p HITS-CLIP 19536157
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
21
GO ID Ontology Definition Evidence Reference
GO:0001784 Function Phosphotyrosine residue binding IBA
GO:0005515 Function Protein binding IPI 12359715, 15929943, 16189514, 16273093, 16730941, 17010654, 17065230, 17235283, 20534575, 21179510, 21516116, 24658140, 24728074, 25036101, 25241761, 25416956, 25814554, 27107012, 28514442, 29997244, 31467278, 31515488, 31980649, 32296183, 32814053, 33961781, 37398436
GO:0005634 Component Nucleus IDA 21179510
GO:0005634 Component Nucleus IEA
GO:0005654 Component Nucleoplasm IBA
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
MIM HGNC e!Ensembl
604518 4563 ENSG00000100351
Protein Protein information from UniProt database.
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
O75791
Protein name GRB2-related adapter protein 2 (Adapter protein GRID) (GRB-2-like protein) (GRB2L) (GRBLG) (GRBX) (Grf40 adapter protein) (Grf-40) (Growth factor receptor-binding protein) (Hematopoietic cell-associated adapter protein GrpL) (P38) (Protein GADS) (SH3-SH2-
Protein function Interacts with SLP-76 to regulate NF-AT activation. Binds to tyrosine-phosphorylated shc.
PDB 5GJH
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00018 SH3_1 4 48 SH3 domain Domain
PF00017 SH2 58 132 SH2 domain Domain
PF00018 SH3_1 277 322 SH3 domain Domain
Sequence
MEAVAKFDFTASGEDELSFHTGDVLKILSNQEEWFKAELGSQEGYVPKNFIDIQFPKWFH
EGLSRHQAENLLMGKEVGFFIIRASQSSPGDFSISVRHEDDVQHFKVMRDNKGNYFLWTE
KFPSLNKLVDYY
RTNSISRQKQIFLRDRTREDQGHRGNSLDRRSQGGPHLSGAVGEEIRP
SMNRKLSDHPPTLPLQQHQHQPQPPQYAPAPQQLQQPPQQRYLQHHHFHQERRGGSLDIN
DGHCGTGLGSEMNAALMHRRHTDPVQLQAAGRVRWARALYDFEALEDDELGFHSGEVVEV
LDSSNPSWWTGRLHNKLGLFPA
NYVAPMTR
Sequence length 330
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  KEGG  Reactome
  T cell receptor signaling pathway   Signaling by SCF-KIT
Generation of second messenger molecules
DAP12 signaling
FCERI mediated MAPK activation
FCERI mediated Ca+2 mobilization
CD28 co-stimulation
Associated diseases Disease associations from ClinVar (causal & non-causal) and other databases (OMIM, Orphanet, GWAS, etc.).
2
Evidence Score: ★☆☆☆☆  Gene-disease association found in Text Mining only ★★☆☆☆  Found in Text Mining and Unknown/Other Associations ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
Phenotype Name Clinical Significance Source Evidence Score
MULTIPLE SCLEROSIS GWAS catalog
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
SYSTEMIC LUPUS ERYTHEMATOSUS GWAS catalog
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
Associations from Text Mining Disease associations identified through text mining
Disease Name Disease (Merged) Source PMID Relationship Type Evidence Score
Acanthosis Nigricans Acanthosis Nigricans BEFREE 22585574
★☆☆☆☆
Found in Text Mining only
Actinic keratosis Actinic keratosis BEFREE 29298652
★☆☆☆☆
Found in Text Mining only
Acute pancreatitis Pancreatitis BEFREE 29349553, 29484391, 29890468, 30718368, 31432106
★☆☆☆☆
Found in Text Mining only
Adenocarcinoma Adenocarcinoma BEFREE 11585739, 27775076, 29761525, 30879017
★☆☆☆☆
Found in Text Mining only
Adenocarcinoma of lung (disorder) Lung adenocarcinoma BEFREE 21164364, 21858220, 22415779, 28900489, 30321617, 30827261, 30879017
★☆☆☆☆
Found in Text Mining only
Adenocarcinoma of pancreas Pancreatic adenocarcinoma BEFREE 15969750, 17078869
★☆☆☆☆
Found in Text Mining only
Adrenocortical carcinoma Adrenocortical carcinoma BEFREE 28114280
★☆☆☆☆
Found in Text Mining only
Adrenoleukodystrophy Adrenoleukodystrophy BEFREE 30298517
★☆☆☆☆
Found in Text Mining only
Adult Medulloblastoma Medulloblastoma BEFREE 22302101, 22855790
★☆☆☆☆
Found in Text Mining only
Adult T-Cell Lymphoma/Leukemia T-Cell Lymphoma/Leukemia BEFREE 17950728
★☆☆☆☆
Found in Text Mining only