Gene Gene information from NCBI Gene database.
Entrez ID 940
Gene name CD28 molecule
Gene symbol CD28
Synonyms (NCBI Gene)
IMD123Tp44
Chromosome 2
Chromosome location 2q33.2
Summary The protein encoded by this gene is essential for T-cell proliferation and survival, cytokine production, and T-helper type-2 development. Several alternatively spliced transcript variants encoding different isoforms have been found for this gene.[provide
miRNA miRNA information provided by mirtarbase database.
235
miRTarBase ID miRNA Experiments Reference
MIRT029645 hsa-miR-26b-5p Microarray 19088304
MIRT438542 hsa-miR-145-5p Luciferase reporter assay 24043548
MIRT438542 hsa-miR-145-5p Luciferase reporter assay 24043548
MIRT684938 hsa-miR-106a-5p HITS-CLIP 23313552
MIRT684937 hsa-miR-106b-5p HITS-CLIP 23313552
Transcription factors Transcription factors information provided by TRRUST V2 database.
4
Transcription factor Regulation Reference
EGR1 Unknown 10510368
NFKB1 Unknown 16365455
RELA Unknown 16365455
SP1 Unknown 10510368
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
60
GO ID Ontology Definition Evidence Reference
GO:0001772 Component Immunological synapse IEA
GO:0001819 Process Positive regulation of cytokine production TAS 8717514
GO:0002376 Process Immune system process IEA
GO:0002863 Process Positive regulation of inflammatory response to antigenic stimulus IEA
GO:0005515 Function Protein binding IPI 7568038, 7584133, 7807015, 8146197, 8183372, 9417079, 9784967, 10820259, 11285224, 15067037, 15554700, 18641334, 21931534
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
MIM HGNC e!Ensembl
186760 1653 ENSG00000178562
Protein Protein information from UniProt database.
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
P10747
Protein name T-cell-specific surface glycoprotein CD28 (TP44) (CD antigen CD28)
Protein function Receptor that plays a role in T-cell activation, proliferation, survival and the maintenance of immune homeostasis (PubMed:1650475, PubMed:7568038). Functions not only as an amplifier of TCR signals but delivers unique signals that control intra
PDB 1YJD , 3WA4 , 5AUL , 5GJH , 5GJI , 6O8D , 7PPN , 7VU5 , 8S6Z , 8W2V
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF15910 V-set_2 23 139 ICOS V-set domain Domain
Tissue specificity TISSUE SPECIFICITY: Expressed in T-cells and plasma cells, but not in less mature B-cells.
Sequence
MLRLLLALNLFPSIQVTGNKILVKQSPMLVAYDNAVNLSCKYSYNLFSREFRASLHKGLD
SAVEVCVVYGNYSQQLQVYSKTGFNCDGKLGNESVTFYLQNLYVNQTDIYFCKIEVMYPP
PYLDNEKSNGTIIHVKGKH
LCPSPLFPGPSKPFWVLVVVGGVLACYSLLVTVAFIIFWVR
SKRSRLLHSDYMNMTPRRPGPTRKHYQPYAPPRDFAAYRS
Sequence length 220
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  KEGG  Reactome
  Cell adhesion molecules
T cell receptor signaling pathway
Intestinal immune network for IgA production
Type I diabetes mellitus
Measles
PD-L1 expression and PD-1 checkpoint pathway in cancer
Autoimmune thyroid disease
Systemic lupus erythematosus
Rheumatoid arthritis
Allograft rejection
Graft-versus-host disease
Viral myocarditis
  PIP3 activates AKT signaling
Nef mediated downregulation of CD28 cell surface expression
Constitutive Signaling by Aberrant PI3K in Cancer
CD28 co-stimulation
CD28 dependent PI3K/Akt signaling
CD28 dependent Vav1 pathway
PI5P, PP2A and IER3 Regulate PI3K/AKT Signaling
Associated diseases Disease associations from ClinVar (causal & non-causal) and other databases (OMIM, Orphanet, GWAS, etc.).
27
Evidence Score: ★☆☆☆☆  Gene-disease association found in Text Mining only ★★☆☆☆  Found in Text Mining and Unknown/Other Associations ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
Phenotype Name Clinical Significance Source Evidence Score
ANKYLOSING SPONDYLITIS GWAS catalog
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
ANKYLOSING SPONDYLITIS AND OTHER INFLAMMATORY SPONDYLOPATHIES Disgenet
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
ARTHRITIS, RHEUMATOID CTD
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
ASTHMA GWAS catalog
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
Associations from Text Mining Disease associations identified through text mining
Disease Name Disease (Merged) Source PMID Relationship Type Evidence Score
Acute Coronary Syndrome Coronary Syndrome BEFREE 20842443, 22282196
★☆☆☆☆
Found in Text Mining only
Acute lymphocytic leukemia Lymphocytic Leukemia BEFREE 10048973, 29637550
★☆☆☆☆
Found in Text Mining only
Adenocarcinoma Adenocarcinoma BEFREE 10741704, 31623615
★☆☆☆☆
Found in Text Mining only
Adenocarcinoma of lung (disorder) Lung adenocarcinoma BEFREE 30152019
★☆☆☆☆
Found in Text Mining only
Adenomatous Polyps Adenomatous Polyposis BEFREE 20140740
★☆☆☆☆
Found in Text Mining only
Adult Diffuse Large B-Cell Lymphoma B-cell Lymphoma BEFREE 31195368
★☆☆☆☆
Found in Text Mining only
Adult Hodgkin Lymphoma Hodgkin Lymphoma BEFREE 28805662
★☆☆☆☆
Found in Text Mining only
Adult T-Cell Lymphoma/Leukemia T-Cell Lymphoma/Leukemia CTD_human_DG 26437031
★☆☆☆☆
Found in Text Mining only
Adult type dermatomyositis Dermatomyositis BEFREE 19752224
★☆☆☆☆
Found in Text Mining only
Age related macular degeneration Age-related macular degeneration BEFREE 23747161
★☆☆☆☆
Found in Text Mining only