Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	9388
Gene name	Lipase G, endothelial type
Gene symbol	LIPG
Synonyms (NCBI Gene)	EDLELPRO719
Chromosome	18
Chromosome location	18q21.1
Summary	The protein encoded by this gene has substantial phospholipase activity and may be involved in lipoprotein metabolism and vascular biology. This protein is designated a member of the TG lipase family by its sequence and characteristic lid region which pro

270

Show/Hide all (270)

miRTarBase ID	miRNA	Experiments	Reference
MIRT017862	hsa-miR-335-5p	Microarray	18185580
MIRT711648	hsa-miR-216a-5p	HITS-CLIP	19536157
MIRT711647	hsa-miR-216b-5p	HITS-CLIP	19536157
MIRT711646	hsa-miR-1228-3p	HITS-CLIP	19536157
MIRT711645	hsa-miR-589-3p	HITS-CLIP	19536157
MIRT711644	hsa-miR-342-3p	HITS-CLIP	19536157
MIRT711643	hsa-miR-4330	HITS-CLIP	19536157
MIRT711642	hsa-miR-564	HITS-CLIP	19536157
MIRT711641	hsa-miR-4284	HITS-CLIP	19536157
MIRT711640	hsa-miR-24-3p	HITS-CLIP	19536157
MIRT670948	hsa-miR-125a-3p	HITS-CLIP	23824327
MIRT670946	hsa-miR-3934-5p	HITS-CLIP	23824327
MIRT670945	hsa-miR-1224-3p	HITS-CLIP	23824327
MIRT670944	hsa-miR-1234-3p	HITS-CLIP	23824327
MIRT670943	hsa-miR-7107-5p	HITS-CLIP	23824327
MIRT670942	hsa-miR-371b-5p	HITS-CLIP	23824327
MIRT670941	hsa-miR-373-5p	HITS-CLIP	23824327
MIRT670940	hsa-miR-616-5p	HITS-CLIP	23824327
MIRT670939	hsa-miR-371a-5p	HITS-CLIP	23824327
MIRT670938	hsa-miR-372-5p	HITS-CLIP	23824327
MIRT670936	hsa-miR-3653-5p	HITS-CLIP	23824327
MIRT679551	hsa-miR-3663-5p	HITS-CLIP	23824327
MIRT670935	hsa-miR-6790-3p	HITS-CLIP	23824327
MIRT670934	hsa-miR-6821-3p	HITS-CLIP	23824327
MIRT679550	hsa-miR-6131	HITS-CLIP	23824327
MIRT670932	hsa-miR-378a-5p	HITS-CLIP	23824327
MIRT670931	hsa-miR-640	HITS-CLIP	23824327
MIRT679549	hsa-miR-6843-3p	HITS-CLIP	23824327
MIRT679548	hsa-miR-6848-3p	HITS-CLIP	23824327
MIRT670948	hsa-miR-125a-3p	HITS-CLIP	23824327
MIRT670947	hsa-miR-764	HITS-CLIP	23824327
MIRT670946	hsa-miR-3934-5p	HITS-CLIP	23824327
MIRT670945	hsa-miR-1224-3p	HITS-CLIP	23824327
MIRT670944	hsa-miR-1234-3p	HITS-CLIP	23824327
MIRT670943	hsa-miR-7107-5p	HITS-CLIP	23824327
MIRT670942	hsa-miR-371b-5p	HITS-CLIP	23824327
MIRT670941	hsa-miR-373-5p	HITS-CLIP	23824327
MIRT670940	hsa-miR-616-5p	HITS-CLIP	23824327
MIRT670939	hsa-miR-371a-5p	HITS-CLIP	23824327
MIRT670938	hsa-miR-372-5p	HITS-CLIP	23824327
MIRT670937	hsa-miR-150-5p	HITS-CLIP	23824327
MIRT670936	hsa-miR-3653-5p	HITS-CLIP	23824327
MIRT670935	hsa-miR-6790-3p	HITS-CLIP	23824327
MIRT670934	hsa-miR-6821-3p	HITS-CLIP	23824327
MIRT670933	hsa-miR-6778-3p	HITS-CLIP	23824327
MIRT670932	hsa-miR-378a-5p	HITS-CLIP	23824327
MIRT670931	hsa-miR-640	HITS-CLIP	23824327
MIRT649843	hsa-miR-4524b-3p	HITS-CLIP	23824327
MIRT649839	hsa-miR-411-5p	HITS-CLIP	23824327
MIRT649842	hsa-miR-6823-5p	HITS-CLIP	23824327
MIRT649841	hsa-miR-4524a-3p	HITS-CLIP	23824327
MIRT649840	hsa-miR-6832-5p	HITS-CLIP	23824327
MIRT649839	hsa-miR-411-5p	HITS-CLIP	23824327
MIRT649838	hsa-miR-197-3p	HITS-CLIP	23824327
MIRT649837	hsa-miR-548s	HITS-CLIP	23824327
MIRT649836	hsa-miR-4701-5p	HITS-CLIP	23824327
MIRT649835	hsa-miR-588	HITS-CLIP	23824327
MIRT649834	hsa-miR-4435	HITS-CLIP	23824327
MIRT649833	hsa-miR-3187-3p	HITS-CLIP	23824327
MIRT649832	hsa-miR-5096	HITS-CLIP	23824327
MIRT649831	hsa-miR-548a-3p	HITS-CLIP	23824327
MIRT649830	hsa-miR-548ar-3p	HITS-CLIP	23824327
MIRT649829	hsa-miR-548az-3p	HITS-CLIP	23824327
MIRT649828	hsa-miR-548e-3p	HITS-CLIP	23824327
MIRT649827	hsa-miR-548f-3p	HITS-CLIP	23824327
MIRT649826	hsa-miR-4495	HITS-CLIP	23824327
MIRT649825	hsa-miR-6777-3p	HITS-CLIP	23824327
MIRT649824	hsa-miR-6509-3p	HITS-CLIP	23824327
MIRT649823	hsa-miR-4436b-5p	HITS-CLIP	23824327
MIRT641555	hsa-miR-6832-3p	HITS-CLIP	23824327
MIRT641554	hsa-miR-31-5p	HITS-CLIP	23824327
MIRT641553	hsa-miR-623	HITS-CLIP	23824327
MIRT641552	hsa-miR-4755-5p	HITS-CLIP	23824327
MIRT641551	hsa-miR-5006-3p	HITS-CLIP	23824327
MIRT641550	hsa-miR-4446-5p	HITS-CLIP	23824327
MIRT570175	hsa-miR-5197-3p	PAR-CLIP	20371350
MIRT570173	hsa-miR-4688	PAR-CLIP	20371350
MIRT570174	hsa-miR-6743-5p	PAR-CLIP	20371350
MIRT570172	hsa-miR-6085	PAR-CLIP	20371350
MIRT570171	hsa-miR-6813-5p	PAR-CLIP	20371350
MIRT570170	hsa-miR-6824-5p	PAR-CLIP	20371350
MIRT570169	hsa-miR-6789-5p	PAR-CLIP	20371350
MIRT570168	hsa-miR-4278	PAR-CLIP	20371350
MIRT570167	hsa-miR-2909	PAR-CLIP	20371350
MIRT711648	hsa-miR-216a-5p	HITS-CLIP	19536157
MIRT711647	hsa-miR-216b-5p	HITS-CLIP	19536157
MIRT711646	hsa-miR-1228-3p	HITS-CLIP	19536157
MIRT711645	hsa-miR-589-3p	HITS-CLIP	19536157
MIRT711644	hsa-miR-342-3p	HITS-CLIP	19536157
MIRT711643	hsa-miR-4330	HITS-CLIP	19536157
MIRT711642	hsa-miR-564	HITS-CLIP	19536157
MIRT711641	hsa-miR-4284	HITS-CLIP	19536157
MIRT711640	hsa-miR-24-3p	HITS-CLIP	19536157
MIRT670948	hsa-miR-125a-3p	HITS-CLIP	23824327
MIRT670946	hsa-miR-3934-5p	HITS-CLIP	23824327
MIRT670945	hsa-miR-1224-3p	HITS-CLIP	23824327
MIRT670944	hsa-miR-1234-3p	HITS-CLIP	23824327
MIRT670943	hsa-miR-7107-5p	HITS-CLIP	23824327
MIRT670942	hsa-miR-371b-5p	HITS-CLIP	23824327
MIRT670941	hsa-miR-373-5p	HITS-CLIP	23824327
MIRT670940	hsa-miR-616-5p	HITS-CLIP	23824327
MIRT670939	hsa-miR-371a-5p	HITS-CLIP	23824327
MIRT670938	hsa-miR-372-5p	HITS-CLIP	23824327
MIRT670936	hsa-miR-3653-5p	HITS-CLIP	23824327
MIRT679551	hsa-miR-3663-5p	HITS-CLIP	23824327
MIRT670935	hsa-miR-6790-3p	HITS-CLIP	23824327
MIRT670934	hsa-miR-6821-3p	HITS-CLIP	23824327
MIRT679550	hsa-miR-6131	HITS-CLIP	23824327
MIRT670932	hsa-miR-378a-5p	HITS-CLIP	23824327
MIRT670931	hsa-miR-640	HITS-CLIP	23824327
MIRT679549	hsa-miR-6843-3p	HITS-CLIP	23824327
MIRT679548	hsa-miR-6848-3p	HITS-CLIP	23824327
MIRT670948	hsa-miR-125a-3p	HITS-CLIP	23824327
MIRT670947	hsa-miR-764	HITS-CLIP	23824327
MIRT670946	hsa-miR-3934-5p	HITS-CLIP	23824327
MIRT670945	hsa-miR-1224-3p	HITS-CLIP	23824327
MIRT670944	hsa-miR-1234-3p	HITS-CLIP	23824327
MIRT670943	hsa-miR-7107-5p	HITS-CLIP	23824327
MIRT670942	hsa-miR-371b-5p	HITS-CLIP	23824327
MIRT670941	hsa-miR-373-5p	HITS-CLIP	23824327
MIRT670940	hsa-miR-616-5p	HITS-CLIP	23824327
MIRT670939	hsa-miR-371a-5p	HITS-CLIP	23824327
MIRT670938	hsa-miR-372-5p	HITS-CLIP	23824327
MIRT670937	hsa-miR-150-5p	HITS-CLIP	23824327
MIRT670936	hsa-miR-3653-5p	HITS-CLIP	23824327
MIRT670935	hsa-miR-6790-3p	HITS-CLIP	23824327
MIRT670934	hsa-miR-6821-3p	HITS-CLIP	23824327
MIRT670933	hsa-miR-6778-3p	HITS-CLIP	23824327
MIRT670932	hsa-miR-378a-5p	HITS-CLIP	23824327
MIRT670931	hsa-miR-640	HITS-CLIP	23824327
MIRT649843	hsa-miR-4524b-3p	HITS-CLIP	23824327
MIRT649839	hsa-miR-411-5p	HITS-CLIP	23824327
MIRT649842	hsa-miR-6823-5p	HITS-CLIP	23824327
MIRT649841	hsa-miR-4524a-3p	HITS-CLIP	23824327
MIRT649840	hsa-miR-6832-5p	HITS-CLIP	23824327
MIRT649839	hsa-miR-411-5p	HITS-CLIP	23824327
MIRT649838	hsa-miR-197-3p	HITS-CLIP	23824327
MIRT649837	hsa-miR-548s	HITS-CLIP	23824327
MIRT649836	hsa-miR-4701-5p	HITS-CLIP	23824327
MIRT649835	hsa-miR-588	HITS-CLIP	23824327
MIRT649834	hsa-miR-4435	HITS-CLIP	23824327
MIRT649833	hsa-miR-3187-3p	HITS-CLIP	23824327
MIRT649832	hsa-miR-5096	HITS-CLIP	23824327
MIRT649831	hsa-miR-548a-3p	HITS-CLIP	23824327
MIRT649830	hsa-miR-548ar-3p	HITS-CLIP	23824327
MIRT649829	hsa-miR-548az-3p	HITS-CLIP	23824327
MIRT649828	hsa-miR-548e-3p	HITS-CLIP	23824327
MIRT649827	hsa-miR-548f-3p	HITS-CLIP	23824327
MIRT649826	hsa-miR-4495	HITS-CLIP	23824327
MIRT649825	hsa-miR-6777-3p	HITS-CLIP	23824327
MIRT649824	hsa-miR-6509-3p	HITS-CLIP	23824327
MIRT649823	hsa-miR-4436b-5p	HITS-CLIP	23824327
MIRT641555	hsa-miR-6832-3p	HITS-CLIP	23824327
MIRT641554	hsa-miR-31-5p	HITS-CLIP	23824327
MIRT641553	hsa-miR-623	HITS-CLIP	23824327
MIRT641552	hsa-miR-4755-5p	HITS-CLIP	23824327
MIRT641551	hsa-miR-5006-3p	HITS-CLIP	23824327
MIRT641550	hsa-miR-4446-5p	HITS-CLIP	23824327
MIRT570175	hsa-miR-5197-3p	PAR-CLIP	20371350
MIRT570173	hsa-miR-4688	PAR-CLIP	20371350
MIRT570174	hsa-miR-6743-5p	PAR-CLIP	20371350
MIRT570172	hsa-miR-6085	PAR-CLIP	20371350
MIRT570171	hsa-miR-6813-5p	PAR-CLIP	20371350
MIRT570170	hsa-miR-6824-5p	PAR-CLIP	20371350
MIRT570169	hsa-miR-6789-5p	PAR-CLIP	20371350
MIRT570168	hsa-miR-4278	PAR-CLIP	20371350
MIRT570167	hsa-miR-2909	PAR-CLIP	20371350
MIRT1110600	hsa-miR-1207-5p	CLIP-seq
MIRT1110601	hsa-miR-1231	CLIP-seq
MIRT1110602	hsa-miR-124	CLIP-seq
MIRT1110603	hsa-miR-1264	CLIP-seq
MIRT1110604	hsa-miR-1292	CLIP-seq
MIRT1110605	hsa-miR-1323	CLIP-seq
MIRT1110606	hsa-miR-216a	CLIP-seq
MIRT1110607	hsa-miR-3064-5p	CLIP-seq
MIRT1110608	hsa-miR-3065-5p	CLIP-seq
MIRT1110609	hsa-miR-3120-5p	CLIP-seq
MIRT1110610	hsa-miR-3128	CLIP-seq
MIRT1110611	hsa-miR-3665	CLIP-seq
MIRT1110612	hsa-miR-421	CLIP-seq
MIRT1110613	hsa-miR-4269	CLIP-seq
MIRT1110614	hsa-miR-4471	CLIP-seq
MIRT1110615	hsa-miR-4645-5p	CLIP-seq
MIRT1110616	hsa-miR-4652-3p	CLIP-seq
MIRT1110617	hsa-miR-4668-3p	CLIP-seq
MIRT1110618	hsa-miR-4673	CLIP-seq
MIRT1110619	hsa-miR-4691-5p	CLIP-seq
MIRT1110620	hsa-miR-4720-5p	CLIP-seq
MIRT1110621	hsa-miR-4736	CLIP-seq
MIRT1110622	hsa-miR-4763-3p	CLIP-seq
MIRT1110623	hsa-miR-4799-3p	CLIP-seq
MIRT1110624	hsa-miR-506	CLIP-seq
MIRT1110625	hsa-miR-541	CLIP-seq
MIRT1110626	hsa-miR-548an	CLIP-seq
MIRT1110627	hsa-miR-548o	CLIP-seq
MIRT1110628	hsa-miR-597	CLIP-seq
MIRT1110629	hsa-miR-604	CLIP-seq
MIRT1110630	hsa-miR-647	CLIP-seq
MIRT1110631	hsa-miR-648	CLIP-seq
MIRT1110632	hsa-miR-654-5p	CLIP-seq
MIRT1110633	hsa-miR-892b	CLIP-seq
MIRT2030907	hsa-miR-4528	CLIP-seq
MIRT2261561	hsa-miR-29a	CLIP-seq
MIRT2261562	hsa-miR-29b	CLIP-seq
MIRT2261563	hsa-miR-29c	CLIP-seq
MIRT2261564	hsa-miR-3663-3p	CLIP-seq
MIRT2261565	hsa-miR-543	CLIP-seq
MIRT2390180	hsa-miR-185	CLIP-seq
MIRT2390181	hsa-miR-24	CLIP-seq
MIRT2390182	hsa-miR-2467-5p	CLIP-seq
MIRT2390183	hsa-miR-3177-5p	CLIP-seq
MIRT2390184	hsa-miR-4306	CLIP-seq
MIRT2390185	hsa-miR-4517	CLIP-seq
MIRT2390186	hsa-miR-4644	CLIP-seq
MIRT2390187	hsa-miR-4672	CLIP-seq
MIRT2390188	hsa-miR-4694-3p	CLIP-seq
MIRT2390189	hsa-miR-4797-3p	CLIP-seq
MIRT2390190	hsa-miR-576-3p	CLIP-seq
MIRT2453071	hsa-miR-494	CLIP-seq
MIRT2561595	hsa-miR-1238	CLIP-seq
MIRT2561596	hsa-miR-1253	CLIP-seq
MIRT2561597	hsa-miR-2277-3p	CLIP-seq
MIRT2561598	hsa-miR-3194-3p	CLIP-seq
MIRT2561599	hsa-miR-329	CLIP-seq
MIRT2561600	hsa-miR-3614-3p	CLIP-seq
MIRT2561601	hsa-miR-362-3p	CLIP-seq
MIRT2561602	hsa-miR-3689d	CLIP-seq
MIRT2561603	hsa-miR-378	CLIP-seq
MIRT2561604	hsa-miR-378b	CLIP-seq
MIRT2561605	hsa-miR-378c	CLIP-seq
MIRT2561606	hsa-miR-378d	CLIP-seq
MIRT2561607	hsa-miR-378e	CLIP-seq
MIRT2561608	hsa-miR-378f	CLIP-seq
MIRT2561609	hsa-miR-378h	CLIP-seq
MIRT2561610	hsa-miR-378i	CLIP-seq
MIRT2561611	hsa-miR-3907	CLIP-seq
MIRT2561612	hsa-miR-3918	CLIP-seq
MIRT2561613	hsa-miR-3922-5p	CLIP-seq
MIRT2561614	hsa-miR-3924	CLIP-seq
MIRT2561615	hsa-miR-3929	CLIP-seq
MIRT2561616	hsa-miR-3938	CLIP-seq
MIRT2561617	hsa-miR-3941	CLIP-seq
MIRT2561618	hsa-miR-422a	CLIP-seq
MIRT2561619	hsa-miR-4251	CLIP-seq
MIRT1110613	hsa-miR-4269	CLIP-seq
MIRT2561620	hsa-miR-4326	CLIP-seq
MIRT2561621	hsa-miR-4419b	CLIP-seq
MIRT2561622	hsa-miR-4478	CLIP-seq
MIRT2561623	hsa-miR-4512	CLIP-seq
MIRT2561624	hsa-miR-4514	CLIP-seq
MIRT2030907	hsa-miR-4528	CLIP-seq
MIRT2561625	hsa-miR-4638-3p	CLIP-seq
MIRT2561626	hsa-miR-466	CLIP-seq
MIRT2390187	hsa-miR-4672	CLIP-seq
MIRT2561627	hsa-miR-4685-5p	CLIP-seq
MIRT2561628	hsa-miR-4692	CLIP-seq
MIRT2561629	hsa-miR-4719	CLIP-seq
MIRT2561630	hsa-miR-4742-5p	CLIP-seq
MIRT2561631	hsa-miR-4757-5p	CLIP-seq
MIRT2561632	hsa-miR-4762-5p	CLIP-seq
MIRT2453071	hsa-miR-494	CLIP-seq
MIRT2561633	hsa-miR-516b	CLIP-seq
MIRT2561634	hsa-miR-603	CLIP-seq
MIRT2561596	hsa-miR-1253	CLIP-seq
MIRT2561613	hsa-miR-3922-5p	CLIP-seq
MIRT2561615	hsa-miR-3929	CLIP-seq
MIRT2561619	hsa-miR-4251	CLIP-seq
MIRT2561621	hsa-miR-4419b	CLIP-seq
MIRT2561622	hsa-miR-4478	CLIP-seq
MIRT2561627	hsa-miR-4685-5p	CLIP-seq

Show/Hide all (38)

GO ID	Ontology	Definition	Evidence	Reference
GO:0004465	Function	Lipoprotein lipase activity	IBA
GO:0004465	Function	Lipoprotein lipase activity	IEA
GO:0004620	Function	Phospholipase activity	IDA	10192396
GO:0004620	Function	Phospholipase activity	IEA
GO:0004806	Function	Triacylglycerol lipase activity	IDA	12032167
GO:0004806	Function	Triacylglycerol lipase activity	IEA
GO:0005576	Component	Extracellular region	IEA
GO:0005576	Component	Extracellular region	TAS
GO:0005615	Component	Extracellular space	IBA
GO:0005615	Component	Extracellular space	IDA	10192396
GO:0005615	Component	Extracellular space	IEA
GO:0005769	Component	Early endosome	IDA	23918928
GO:0005794	Component	Golgi apparatus	IDA	23918928
GO:0006629	Process	Lipid metabolic process	IEA
GO:0006629	Process	Lipid metabolic process	TAS	10192396, 10318835
GO:0006633	Process	Fatty acid biosynthetic process	IBA
GO:0007584	Process	Response to nutrient	IEA
GO:0008201	Function	Heparin binding	IEA
GO:0008970	Function	Phospholipase A1 activity	IBA
GO:0008970	Function	Phospholipase A1 activity	IDA	10318835, 12032167
GO:0008970	Function	Phospholipase A1 activity	IEA
GO:0008970	Function	Phospholipase A1 activity	TAS	10318835
GO:0009395	Process	Phospholipid catabolic process	NAS	19136670
GO:0009986	Component	Cell surface	IDA	23918928
GO:0010983	Process	Positive regulation of high-density lipoprotein particle clearance	IMP	19136670
GO:0016042	Process	Lipid catabolic process	IEA
GO:0016298	Function	Lipase activity	IEA
GO:0016787	Function	Hydrolase activity	IEA
GO:0019433	Process	Triglyceride catabolic process	IBA
GO:0032376	Process	Positive regulation of cholesterol transport	IDA	19136670
GO:0034375	Process	High-density lipoprotein particle remodeling	IBA
GO:0034375	Process	High-density lipoprotein particle remodeling	IMP	19136670
GO:0042632	Process	Cholesterol homeostasis	IBA
GO:0042632	Process	Cholesterol homeostasis	IMP	19136670
GO:0043691	Process	Reverse cholesterol transport	IMP	19136670
GO:0050746	Process	Regulation of lipoprotein metabolic process	IEA
GO:0052689	Function	Carboxylic ester hydrolase activity	IEA
GO:0055091	Process	Phospholipid homeostasis	IMP	19136670

MIM	HGNC	e!Ensembl
603684	6623	ENSG00000101670

Q9Y5X9

Protein name

Endothelial lipase (EC 3.1.1.3) (Endothelial cell-derived lipase) (EDL) (EL) (Phospholipase A1) (EC 3.1.1.32)

Protein function

Exerts both phospholipase and triglyceride lipase activities (PubMed:10192396, PubMed:10318835, PubMed:12032167). More active as a phospholipase than a triglyceride lipase (PubMed:12032167). Hydrolyzes triglycerides, both with short-chain fatty

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00151	Lipase	13 → 344	Lipase	Domain
PF01477	PLAT	349 → 481	PLAT/LH2 domain	Domain

Tissue specificity

TISSUE SPECIFICITY: High level of expression in the liver, placenta, lung, thyroid, kidney, testis and in the corpus luteum of the ovary. Expressed also in coronary artery endothelial cells, umbilical vein endothelial cells and in hepatocytes and osteosar

Sequence

MSNSVPLLCFWSLCYCFAAGSPVPFGPEGRLEDKLHKPKATQTEVKPSVRFNLRTSKDPE
HEGCYLSVGHSQPLEDCSFNMTAKTFFIIHGWTMSGIFENWLHKLVSALHTREKDANVVV
VDWLPLAHQLYTDAVNNTRVVGHSIARMLDWLQEKDDFSLGNVHLIGYSLGAHVAGYAGN
FVKGTVGRITGLDPAGPMFEGADIHKRLSPDDADFVDVLHTYTRSFGLSIGIQMPVGHID
IYPNGGDFQPGCGLNDVLGSIAYGTITEVVKCEHERAVHLFVDSLVNQDKPSFAFQCTDS
NRFKKGICLSCRKNRCNSIGYNAKKMRNKRNSKMYLKTRAGMPFRVYHYQMKIHVFSYKN
MGEIEPTFYVTLYGTNADSQTLPLEIVERIEQNATNTFLVYTEEDLGDLLKIQLTWEGAS
QSWYNLWKEFRSYLSQPRNPGRELNIRRIRVKSGETQRKLTFCTEDPENTSISPGRELWF
RKCRDGWRMKNETSPTVELP

Sequence length

500

Interactions

View interactions

	KEGG		Reactome
	Glycerolipid metabolism Metabolic pathways Cholesterol metabolism		HDL remodeling

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (23)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
ALZHEIMER DISEASE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CARDIOVASCULAR DISEASES	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CEREBRAL INFARCTION	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Cholangiocarcinoma	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CHRONIC ISCHEMIC HEART DISEASE	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Clear cell carcinoma of kidney	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Colorectal cancer	Uncertain significance	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CORONARY ARTERIOSCLEROSIS	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CORONARY ARTERY DISEASE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CORONARY HEART DISEASE	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Familial cancer of breast	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LIPG-related disorder	Benign; Likely benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Lung cancer	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
METABOLIC SYNDROME	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MULTIPLE SCLEROSIS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MYOCARDIAL INFARCTION	—	Disgenet, GWAS catalog Disgenet, GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MYOCARDIAL ISCHEMIA	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OBESITY	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Ovarian serous cystadenocarcinoma	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TESTICULAR CARCINOMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TESTICULAR GERM CELL TUMOR	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TYPE 2 DIABETES MELLITUS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Uterine corpus endometrial carcinoma	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (64)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Acute Coronary Syndrome	Coronary Syndrome	BEFREE	22723003, 25291260		★★★★★ ★☆☆☆☆ Found in Text Mining only
Alzheimer`s Disease	Alzheimer disease	GWASCAT_DG	30805717		★★★★★ ★☆☆☆☆ Found in Text Mining only
Anemia, Sickle Cell	Anemia	BEFREE	30114530		★★★★★ ★☆☆☆☆ Found in Text Mining only
Arteriosclerosis	Arteriosclerosis	BEFREE	12401876, 16354105, 20621031, 20962428, 21424685, 22240910, 23102786, 23243195, 23673478, 27430252, 28540715, 28546217, 29748333, 30613337, 31473149		★★★★★ ★☆☆☆☆ Found in Text Mining only
Atherosclerosis	Atherosclerosis	BEFREE	12401876, 16354105, 20621031, 20962428, 21424685, 22240910, 23102786, 23243195, 23673478, 27430252, 28540715, 28546217, 29748333, 30613337, 31473149		★★★★★ ★☆☆☆☆ Found in Text Mining only
Atherosclerosis	Atherosclerosis	Pubtator	15961789, 16177180, 16354105, 17093291, 17526978, 23991054, 25250890, 27430252	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Autistic Disorder	Autism	GWASDB_DG	22843504		★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	27045898, 30653260		★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	30653260	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cardiovascular Diseases	Cardiovascular Diseases	LHGDN	16023652		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Cardiovascular Diseases	Cardiovascular Diseases	BEFREE	16498510, 20045866, 22723003, 30348490, 31519373		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Cardiovascular Diseases	Cardiovascular disease	Pubtator	25250890	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Carotid Stenosis	Carotid artery stenosis	Pubtator	21842303	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cholesteryl Ester Transfer Protein Deficiency	Hyperalphalipoproteinemia	BEFREE	22464213		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colitis Ulcerative	Ulcerative colitis	Pubtator	39596612	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	28506205, 35108261	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Coronary Arteriosclerosis	Coronary Arteriosclerosis	BEFREE	17986713, 19411665, 23243195, 24634127, 24886585, 26124511, 27600285, 27612170, 30150432, 31020688, 31473149		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Coronary Artery Disease	Coronary artery disease	Pubtator	16354105, 17986713, 23243195, 26124511, 27600285, 27612170, 30150432	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Coronary Artery Disease	Coronary artery disease	BEFREE	17986713, 18212282, 19411665, 20466371, 23243195, 24634127, 24886585, 26124511, 27600285, 27612170, 30150432, 30651409, 31020688, 31473149		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Coronary Artery Disease	Coronary artery disease	LHGDN	17986713		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Coronary Disease	Coronary artery disease	Pubtator	19411665	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Coronary heart disease	Coronary Heart Disease	BEFREE	17986713, 18212282, 19411665, 23243195, 24634127, 24886585, 26124511, 27600285, 27612170, 30150432, 31020688, 31473149		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Deep Vein Thrombosis	Thrombosis	BEFREE	20466371		★★★★★ ★☆☆☆☆ Found in Text Mining only
Dementia	Dementia	BEFREE	31216999		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes mellitus	Pubtator	16940551	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes mellitus	Pubtator	17986713, 28739185	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus Type 1	Diabetes mellitus, type 1	Pubtator	16940551	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus Type 2	Diabetes mellitus, type 2	Pubtator	23552671	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Non-Insulin-Dependent	Diabetes Mellitus	BEFREE	18433755, 21145773, 24852509, 27590083, 28207876		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetic Retinopathy	Diabetic Retinopathy	BEFREE	21145773, 24852509		★★★★★ ★☆☆☆☆ Found in Text Mining only
Dyslipidemias	Dyslipidemias	Pubtator	15961789, 29084231, 30621702	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Dyslipidemias	Dyslipidemias	BEFREE	17700364		★★★★★ ★☆☆☆☆ Found in Text Mining only
Endometriosis	Endometriosis	BEFREE	30356372		★★★★★ ★☆☆☆☆ Found in Text Mining only
Eye Neoplasms	Eye Neoplasms	BEFREE	21730846		★★★★★ ★☆☆☆☆ Found in Text Mining only
Germ cell tumor	Tumor	BEFREE	19780863		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hemolytic-Uremic Syndrome	Hemolytic Uremic Syndrome	BEFREE	14605120		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypercholesterolemia	Hypercholesterolemia	BEFREE	20045866, 28546217, 30270055		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypercholesterolemia, Familial	Hypercholesterolemia	BEFREE	27039080		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hyperlipidemias	Hyperlipidemia	Pubtator	17986713, 23991054, 25291260	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hyperlipoproteinemia Type II	Hyperlipoproteinemia	Pubtator	27039080	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hyperlipoproteinemia Type IIa	Hyperlipoproteinemia	BEFREE	27039080		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypertensive disease	Hypertension	BEFREE	15914124		★★★★★ ★☆☆☆☆ Found in Text Mining only
Impaired cognition	Impaired Cognition	BEFREE	31216999		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	27045898, 30653260		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	19082487, 28540715, 29350614, 30356372		★★★★★ ★☆☆☆☆ Found in Text Mining only
Metabolic Diseases	Metabolic syndrome	Pubtator	29084231	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Metabolic Syndrome	Metabolic syndrome	Pubtator	16354105, 19380136, 36606668	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Metabolic Syndrome X	Metabolic Syndrome	BEFREE	16354105, 16498510, 18212282, 19380136, 28446761, 28540715		★★★★★ ★☆☆☆☆ Found in Text Mining only
Muscular Dystrophy, Duchenne	Duchenne Muscular Dystrophy	BEFREE	29879154		★★★★★ ★☆☆☆☆ Found in Text Mining only
Myocardial Infarction	Myocardial Infarction	LHGDN	17526978		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Myocardial Infarction	Myocardial infarction	Pubtator	17526978, 17986713	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Myocardial Infarction	Myocardial Infarction	BEFREE	22607825		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Neoplasms	Neoplasms	BEFREE	28506205		★★★★★ ★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	BEFREE	18212282, 21852675		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Obesity	Obesity	Pubtator	36371454	Inhibit	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Obesity	Obesity	Pubtator	36982283	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Ovarian Neoplasms	Ovarian neoplasm	Pubtator	37417299	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Presenile dementia	Senile Dementia	BEFREE	31216999		★★★★★ ★☆☆☆☆ Found in Text Mining only
Retinoblastoma	Retinoblastoma	BEFREE	21730846		★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	23510199	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Triple Negative Breast Neoplasms	Triple Negative Breast Neoplasms	BEFREE	29350614		★★★★★ ★☆☆☆☆ Found in Text Mining only
Uterine Cervical Neoplasms	Uterine neoplasm	Pubtator	36606668	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Uveal melanoma	Uveal Melanoma	BEFREE	21730846		★★★★★ ★☆☆☆☆ Found in Text Mining only
Vascular Diseases	Vascular Diseases	BEFREE	15914124, 24680225		★★★★★ ★☆☆☆☆ Found in Text Mining only

LIPG (lipase G, endothelial type)