SLC22A8 (solute carrier family 22 member 8)

Gene

• Entrez ID: 9376
• Gene name: Solute carrier family 22 member 8
• Gene symbol: SLC22A8
• Synonyms (NCBI Gene): OAT3
• Chromosome: 11
• Chromosome location: 11q12.3
• Summary: This gene encodes a protein involved in the sodium-independent transport and excretion of organic anions, some of which are potentially toxic. The encoded protein is an integral membrane protein and appears to be localized to the basolateral membrane of t

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT028886	hsa-miR-26b-5p	Microarray	19088304
MIRT1354596	hsa-miR-1207-5p	CLIP-seq
MIRT1354597	hsa-miR-3153	CLIP-seq
MIRT1354598	hsa-miR-326	CLIP-seq
MIRT1354599	hsa-miR-330-5p	CLIP-seq
MIRT1354600	hsa-miR-3616-3p	CLIP-seq
MIRT1354601	hsa-miR-4436b-3p	CLIP-seq
MIRT1354602	hsa-miR-4661-3p	CLIP-seq
MIRT1354603	hsa-miR-4763-3p	CLIP-seq
MIRT1354604	hsa-miR-4794	CLIP-seq
MIRT1354605	hsa-miR-516b	CLIP-seq
MIRT1354606	hsa-miR-593	CLIP-seq
MIRT1354607	hsa-miR-622	CLIP-seq
MIRT1354601	hsa-miR-4436b-3p	CLIP-seq

Transcription factors

Transcription factor	Regulation	Reference
ATF1	Unknown	16809478
CREB1	Unknown	16809478

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005452	Function	Solute:inorganic anion antiporter activity	IDA	15037815
GO:0005886	Component	Plasma membrane	IEA
GO:0005886	Component	Plasma membrane	TAS
GO:0006811	Process	Monoatomic ion transport	IEA
GO:0006869	Process	Lipid transport	IEA
GO:0008514	Function	Organic anion transmembrane transporter activity	IDA	11907186, 14675047, 22108572, 23832370, 26377792, 28534121
GO:0008514	Function	Organic anion transmembrane transporter activity	IEA
GO:0008514	Function	Organic anion transmembrane transporter activity	TAS
GO:0009636	Process	Response to toxic substance	IEA
GO:0009925	Component	Basal plasma membrane	IEA
GO:0015132	Function	Prostaglandin transmembrane transporter activity	IDA	11907186
GO:0015297	Function	Antiporter activity	IEA
GO:0015698	Process	Inorganic anion transport	IEA
GO:0015711	Process	Organic anion transport	IBA
GO:0015732	Process	Prostaglandin transport	IDA	11907186
GO:0016020	Component	Membrane	IEA
GO:0016323	Component	Basolateral plasma membrane	IDA	15037815, 27053689, 31791063
GO:0016323	Component	Basolateral plasma membrane	IEA
GO:0016323	Component	Basolateral plasma membrane	ISS	18619525
GO:0016324	Component	Apical plasma membrane	IDA	31791063
GO:0016324	Component	Apical plasma membrane	IEA
GO:0016324	Component	Apical plasma membrane	ISS	18619525
GO:0022857	Function	Transmembrane transporter activity	IEA
GO:0042908	Process	Xenobiotic transport	IEA
GO:0042910	Function	Xenobiotic transmembrane transporter activity	IDA	11669456
GO:0055085	Process	Transmembrane transport	IEA
GO:0070062	Component	Extracellular exosome	HDA	19056867
GO:0150104	Process	Transport across blood-brain barrier	NAS	26590417

Other IDs

• MIM: 607581
• HGNC: 10972
• e!Ensembl: ENSG00000149452

Protein

• UniProt ID: Q8TCC7
• Protein name: Organic anion transporter 3 (hOAT3) (Organic anion/dicarboxylate exchanger) (Solute carrier family 22 member 8)
• Protein function: Functions as an organic anion/dicarboxylate exchanger that couples organic anion uptake indirectly to the sodium gradient (PubMed:14586168, PubMed:15644426, PubMed:15846473, PubMed:16455804, PubMed:31553721). Transports organic anions such as es
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00083	Sugar_tr	80 → 507	Sugar (and other) transporter	Family

• Tissue specificity: TISSUE SPECIFICITY: Strongly expressed in kidney (PubMed:11306713, PubMed:11912245). Weaker expression in brain and skeletal muscle (PubMed:11306713). Expressed in adrenal glands (PubMed:15864504). {ECO:0000269|PubMed:11306713, ECO:0000269|PubMed:11912245
• Sequence:

  MTFSEILDRVGSMGHFQFLHVAILGLPILNMANHNLLQIFTAATPVHHCRPPHNASTGPW
  VLPMGPNGKPERCLRFVHPPNASLPNDTQRAMEPCLDGWVYNSTKDSIVTEWDLVCNSNK
  LKEMAQSIFMAGILIGGLVLGDLSDRFGRRPILTCSYLLLAASGSGAAFSPTFPIYMVFR
  FLCGFGISGITLSTVILNVEWVPTRMRAIMSTALGYCYTFGQFILPGLAYAIPQWRWLQL
  TVSIPFFVFFLSSWWTPESIRWLVLSGKSSKALKILRRVAVFNGKKEEGERLSLEELKLN
  LQKEISLAKAKYTASDLFRIPMLRRMTFCLSLAWFATGFAYYSLAMGVEEFGVNLYILQI
  IFGGVDVPAKFITILSLSYLGRHTTQAAALLLAGGAILALTFVPLDLQTVRTVLAVFGKG
  CLSSSFSCLFLYTSELYPTVIRQTGMGVSNLWTRVGSMVSPLVKITGEVQPFIPNIIYGI
  TALLGGSAALFLPETLNQPLPETIEDLENWSLRAKKPKQEPEVEKASQRIPLQPHGPGLG
  SS

• Sequence length: 542

Pathways

KEGG:

Bile secretion
Folate transport and metabolism

Reactome:

Organic anion transport

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
Clear cell carcinoma of kidney	Likely benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
FATTY LIVER	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
FATTY LIVER, ALCOHOLIC	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LIVER CIRRHOSIS	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LIVER CIRRHOSIS, EXPERIMENTAL	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Nonpapillary renal cell carcinoma	Likely benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	33741523	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Renal Cell	Renal cell carcinoma	Pubtator	36123895, 37657024	Associate	★☆☆☆☆ Found in Text Mining only
Cholestasis Extrahepatic	Cholelithiasis	Pubtator	19034961	Associate	★☆☆☆☆ Found in Text Mining only
Chronic Lymphocytic Leukemia	Lymphocytic Leukemia	BEFREE	25477469		★☆☆☆☆ Found in Text Mining only
Coronary Arteriosclerosis	Coronary Arteriosclerosis	BEFREE	31125610		★☆☆☆☆ Found in Text Mining only
Diabetic Nephropathies	Diabetic neuropathy	Pubtator	23949796	Inhibit	★☆☆☆☆ Found in Text Mining only
Diabetic Nephropathy	Diabetic Nephropathy	BEFREE	23949796		★☆☆☆☆ Found in Text Mining only
Fatty Liver	Fatty Liver	CTD_human_DG	25226513		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Fibrosis, Liver	Liver Fibrosis	CTD_human_DG	25226513		★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	BEFREE	31664714		★☆☆☆☆ Found in Text Mining only
Glioblastoma Multiforme	Glioblastoma	BEFREE	31664714		★☆☆☆☆ Found in Text Mining only
Gout	Gout	Pubtator	35406626	Associate	★☆☆☆☆ Found in Text Mining only
Hyperglycemia	Hyperglycemia	BEFREE	29051569		★☆☆☆☆ Found in Text Mining only
Hypertensive disease	Hypertension	BEFREE	21164499		★☆☆☆☆ Found in Text Mining only
Hyperuricemia	Hyperuricemia	BEFREE	26907620, 27614971		★☆☆☆☆ Found in Text Mining only
Kidney Diseases	Kidney Disease	BEFREE	14984259		★☆☆☆☆ Found in Text Mining only
Kidney Failure, Acute	Kidney Failure	BEFREE	19837111, 30047127, 31125610		★☆☆☆☆ Found in Text Mining only
Liver Cirrhosis	Liver Cirrhosis	CTD_human_DG	25226513		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Liver Diseases Alcoholic	Liver disease	Pubtator	36328481	Inhibit	★☆☆☆☆ Found in Text Mining only
Lymphoma	Lymphoma	Pubtator	25477469	Associate	★☆☆☆☆ Found in Text Mining only
Metabolic Diseases	Metabolic Diseases	BEFREE	29980603		★☆☆☆☆ Found in Text Mining only
Myocardial Ischemia	Myocardial Ischemia	BEFREE	31125610		★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	BEFREE	29483238, 31475894		★☆☆☆☆ Found in Text Mining only
Oculocerebrorenal Syndrome	Oculocerebrorenal Syndrome	BEFREE	25485598		★☆☆☆☆ Found in Text Mining only
Renal Insufficiency	Renal Insufficiency	BEFREE	29195834, 30919935		★☆☆☆☆ Found in Text Mining only
Steatohepatitis	Fatty Liver	CTD_human_DG	25226513		★☆☆☆☆ Found in Text Mining only
Vitamin D Deficiency	Vitamin D Deficiency	BEFREE	29243851		★☆☆☆☆ Found in Text Mining only