Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene SNPs miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	9368
Gene name	NHERF family PDZ scaffold protein 1
Gene symbol	NHERF1
Synonyms (NCBI Gene)	EBP50NHE-RFNHERFNHERF-1NPHLOP2SLC9A3R1
Chromosome	17
Chromosome location	17q25.1

Show/Hide all (1)

SNP ID	Visualize variation	Clinical significance	Consequence
rs119486097	G>A	Pathogenic, likely-benign, likely-pathogenic	Coding sequence variant, non coding transcript variant, missense variant

428

Show/Hide all (428)

miRTarBase ID	miRNA	Experiments	Reference
MIRT018193	hsa-miR-335-5p	Microarray	18185580
MIRT032319	hsa-let-7b-5p	Proteomics	18668040
MIRT038082	hsa-miR-423-5p	CLASH	23622248
MIRT036977	hsa-miR-877-3p	CLASH	23622248
MIRT1368669	hsa-miR-1	CLIP-seq
MIRT1368670	hsa-miR-1184	CLIP-seq
MIRT1368671	hsa-miR-1205	CLIP-seq
MIRT1368672	hsa-miR-1207-5p	CLIP-seq
MIRT1368673	hsa-miR-1251	CLIP-seq
MIRT1368674	hsa-miR-1252	CLIP-seq
MIRT1368675	hsa-miR-1255a	CLIP-seq
MIRT1368676	hsa-miR-1255b	CLIP-seq
MIRT1368677	hsa-miR-1263	CLIP-seq
MIRT1368678	hsa-miR-1265	CLIP-seq
MIRT1368679	hsa-miR-1266	CLIP-seq
MIRT1368680	hsa-miR-1275	CLIP-seq
MIRT1368681	hsa-miR-1291	CLIP-seq
MIRT1368682	hsa-miR-146b-3p	CLIP-seq
MIRT1368683	hsa-miR-149	CLIP-seq
MIRT1368684	hsa-miR-181a	CLIP-seq
MIRT1368685	hsa-miR-181b	CLIP-seq
MIRT1368686	hsa-miR-181c	CLIP-seq
MIRT1368687	hsa-miR-181d	CLIP-seq
MIRT1368688	hsa-miR-1909	CLIP-seq
MIRT1368689	hsa-miR-1915	CLIP-seq
MIRT1368690	hsa-miR-194	CLIP-seq
MIRT1368691	hsa-miR-2053	CLIP-seq
MIRT1368692	hsa-miR-206	CLIP-seq
MIRT1368693	hsa-miR-2110	CLIP-seq
MIRT1368694	hsa-miR-2117	CLIP-seq
MIRT1368695	hsa-miR-2392	CLIP-seq
MIRT1368696	hsa-miR-24	CLIP-seq
MIRT1368697	hsa-miR-2964a-5p	CLIP-seq
MIRT1368698	hsa-miR-299-3p	CLIP-seq
MIRT1368699	hsa-miR-3127-5p	CLIP-seq
MIRT1368700	hsa-miR-3148	CLIP-seq
MIRT1368701	hsa-miR-3150a-3p	CLIP-seq
MIRT1368702	hsa-miR-3158-5p	CLIP-seq
MIRT1368703	hsa-miR-3168	CLIP-seq
MIRT1368704	hsa-miR-3173-5p	CLIP-seq
MIRT1368705	hsa-miR-3175	CLIP-seq
MIRT1368706	hsa-miR-3202	CLIP-seq
MIRT1368707	hsa-miR-323-5p	CLIP-seq
MIRT1368708	hsa-miR-339-5p	CLIP-seq
MIRT1368709	hsa-miR-342-5p	CLIP-seq
MIRT1368710	hsa-miR-345	CLIP-seq
MIRT1368711	hsa-miR-3622b-5p	CLIP-seq
MIRT1368712	hsa-miR-3665	CLIP-seq
MIRT1368713	hsa-miR-3673	CLIP-seq
MIRT1368714	hsa-miR-3688-5p	CLIP-seq
MIRT1368715	hsa-miR-3690	CLIP-seq
MIRT1368716	hsa-miR-383	CLIP-seq
MIRT1368717	hsa-miR-3914	CLIP-seq
MIRT1368718	hsa-miR-3929	CLIP-seq
MIRT1368719	hsa-miR-4256	CLIP-seq
MIRT1368720	hsa-miR-4261	CLIP-seq
MIRT1368721	hsa-miR-4262	CLIP-seq
MIRT1368722	hsa-miR-4270	CLIP-seq
MIRT1368723	hsa-miR-4277	CLIP-seq
MIRT1368724	hsa-miR-4281	CLIP-seq
MIRT1368725	hsa-miR-4284	CLIP-seq
MIRT1368726	hsa-miR-4290	CLIP-seq
MIRT1368727	hsa-miR-4308	CLIP-seq
MIRT1368728	hsa-miR-4419b	CLIP-seq
MIRT1368729	hsa-miR-4434	CLIP-seq
MIRT1368730	hsa-miR-4441	CLIP-seq
MIRT1368731	hsa-miR-4470	CLIP-seq
MIRT1368732	hsa-miR-4475	CLIP-seq
MIRT1368733	hsa-miR-4476	CLIP-seq
MIRT1368734	hsa-miR-4477b	CLIP-seq
MIRT1368735	hsa-miR-4478	CLIP-seq
MIRT1368736	hsa-miR-4496	CLIP-seq
MIRT1368737	hsa-miR-4514	CLIP-seq
MIRT1368738	hsa-miR-4516	CLIP-seq
MIRT1368739	hsa-miR-4518	CLIP-seq
MIRT1368740	hsa-miR-4525	CLIP-seq
MIRT1368741	hsa-miR-4645-5p	CLIP-seq
MIRT1368742	hsa-miR-4649-3p	CLIP-seq
MIRT1368743	hsa-miR-4651	CLIP-seq
MIRT1368744	hsa-miR-4659a-5p	CLIP-seq
MIRT1368745	hsa-miR-4659b-5p	CLIP-seq
MIRT1368746	hsa-miR-4662a-5p	CLIP-seq
MIRT1368747	hsa-miR-4664-5p	CLIP-seq
MIRT1368748	hsa-miR-4665-5p	CLIP-seq
MIRT1368749	hsa-miR-4673	CLIP-seq
MIRT1368750	hsa-miR-4681	CLIP-seq
MIRT1368751	hsa-miR-4684-5p	CLIP-seq
MIRT1368752	hsa-miR-4690-3p	CLIP-seq
MIRT1368753	hsa-miR-4692	CLIP-seq
MIRT1368754	hsa-miR-4704-3p	CLIP-seq
MIRT1368755	hsa-miR-4717-3p	CLIP-seq
MIRT1368756	hsa-miR-4720-5p	CLIP-seq
MIRT1368757	hsa-miR-4722-3p	CLIP-seq
MIRT1368758	hsa-miR-4723-5p	CLIP-seq
MIRT1368759	hsa-miR-4726-3p	CLIP-seq
MIRT1368760	hsa-miR-4728-5p	CLIP-seq
MIRT1368761	hsa-miR-4729	CLIP-seq
MIRT1368762	hsa-miR-4734	CLIP-seq
MIRT1368763	hsa-miR-4738-5p	CLIP-seq
MIRT1368764	hsa-miR-4762-3p	CLIP-seq
MIRT1368765	hsa-miR-4763-3p	CLIP-seq
MIRT1368766	hsa-miR-4764-5p	CLIP-seq
MIRT1368767	hsa-miR-4766-5p	CLIP-seq
MIRT1368768	hsa-miR-4769-3p	CLIP-seq
MIRT1368769	hsa-miR-4772-5p	CLIP-seq
MIRT1368770	hsa-miR-4799-3p	CLIP-seq
MIRT1368771	hsa-miR-544	CLIP-seq
MIRT1368772	hsa-miR-548c-3p	CLIP-seq
MIRT1368773	hsa-miR-561	CLIP-seq
MIRT1368774	hsa-miR-569	CLIP-seq
MIRT1368775	hsa-miR-579	CLIP-seq
MIRT1368776	hsa-miR-608	CLIP-seq
MIRT1368777	hsa-miR-613	CLIP-seq
MIRT1368778	hsa-miR-619	CLIP-seq
MIRT1368779	hsa-miR-625	CLIP-seq
MIRT1368780	hsa-miR-639	CLIP-seq
MIRT1368781	hsa-miR-657	CLIP-seq
MIRT1368782	hsa-miR-660	CLIP-seq
MIRT1368783	hsa-miR-711	CLIP-seq
MIRT1368784	hsa-miR-759	CLIP-seq
MIRT1368785	hsa-miR-874	CLIP-seq
MIRT1368786	hsa-miR-876-3p	CLIP-seq
MIRT1368787	hsa-miR-939	CLIP-seq
MIRT1368788	hsa-miR-940	CLIP-seq
MIRT1368669	hsa-miR-1	CLIP-seq
MIRT1368670	hsa-miR-1184	CLIP-seq
MIRT1368671	hsa-miR-1205	CLIP-seq
MIRT1368672	hsa-miR-1207-5p	CLIP-seq
MIRT1368673	hsa-miR-1251	CLIP-seq
MIRT1368674	hsa-miR-1252	CLIP-seq
MIRT1368675	hsa-miR-1255a	CLIP-seq
MIRT1368676	hsa-miR-1255b	CLIP-seq
MIRT1368677	hsa-miR-1263	CLIP-seq
MIRT1368678	hsa-miR-1265	CLIP-seq
MIRT1368679	hsa-miR-1266	CLIP-seq
MIRT1368680	hsa-miR-1275	CLIP-seq
MIRT1368682	hsa-miR-146b-3p	CLIP-seq
MIRT1368683	hsa-miR-149	CLIP-seq
MIRT1368684	hsa-miR-181a	CLIP-seq
MIRT1368685	hsa-miR-181b	CLIP-seq
MIRT1368686	hsa-miR-181c	CLIP-seq
MIRT1368687	hsa-miR-181d	CLIP-seq
MIRT1368688	hsa-miR-1909	CLIP-seq
MIRT1368689	hsa-miR-1915	CLIP-seq
MIRT1368690	hsa-miR-194	CLIP-seq
MIRT2109596	hsa-miR-200b	CLIP-seq
MIRT2109597	hsa-miR-200c	CLIP-seq
MIRT1368691	hsa-miR-2053	CLIP-seq
MIRT1368692	hsa-miR-206	CLIP-seq
MIRT1368693	hsa-miR-2110	CLIP-seq
MIRT1368694	hsa-miR-2117	CLIP-seq
MIRT2109598	hsa-miR-217	CLIP-seq
MIRT2109599	hsa-miR-2276	CLIP-seq
MIRT1368695	hsa-miR-2392	CLIP-seq
MIRT1368696	hsa-miR-24	CLIP-seq
MIRT1368697	hsa-miR-2964a-5p	CLIP-seq
MIRT1368698	hsa-miR-299-3p	CLIP-seq
MIRT2109600	hsa-miR-3064-3p	CLIP-seq
MIRT1368699	hsa-miR-3127-5p	CLIP-seq
MIRT1368700	hsa-miR-3148	CLIP-seq
MIRT1368701	hsa-miR-3150a-3p	CLIP-seq
MIRT1368702	hsa-miR-3158-5p	CLIP-seq
MIRT1368703	hsa-miR-3168	CLIP-seq
MIRT1368704	hsa-miR-3173-5p	CLIP-seq
MIRT1368705	hsa-miR-3175	CLIP-seq
MIRT1368706	hsa-miR-3202	CLIP-seq
MIRT1368707	hsa-miR-323-5p	CLIP-seq
MIRT1368708	hsa-miR-339-5p	CLIP-seq
MIRT1368709	hsa-miR-342-5p	CLIP-seq
MIRT1368710	hsa-miR-345	CLIP-seq
MIRT1368711	hsa-miR-3622b-5p	CLIP-seq
MIRT2109601	hsa-miR-3664-3p	CLIP-seq
MIRT1368712	hsa-miR-3665	CLIP-seq
MIRT1368713	hsa-miR-3673	CLIP-seq
MIRT1368714	hsa-miR-3688-5p	CLIP-seq
MIRT1368715	hsa-miR-3690	CLIP-seq
MIRT1368716	hsa-miR-383	CLIP-seq
MIRT1368717	hsa-miR-3914	CLIP-seq
MIRT1368718	hsa-miR-3929	CLIP-seq
MIRT2109602	hsa-miR-4252	CLIP-seq
MIRT1368719	hsa-miR-4256	CLIP-seq
MIRT1368721	hsa-miR-4262	CLIP-seq
MIRT1368722	hsa-miR-4270	CLIP-seq
MIRT1368723	hsa-miR-4277	CLIP-seq
MIRT1368724	hsa-miR-4281	CLIP-seq
MIRT1368725	hsa-miR-4284	CLIP-seq
MIRT2109603	hsa-miR-429	CLIP-seq
MIRT1368726	hsa-miR-4290	CLIP-seq
MIRT2109604	hsa-miR-4305	CLIP-seq
MIRT1368727	hsa-miR-4308	CLIP-seq
MIRT2109605	hsa-miR-4418	CLIP-seq
MIRT1368728	hsa-miR-4419b	CLIP-seq
MIRT1368729	hsa-miR-4434	CLIP-seq
MIRT1368730	hsa-miR-4441	CLIP-seq
MIRT1368731	hsa-miR-4470	CLIP-seq
MIRT1368732	hsa-miR-4475	CLIP-seq
MIRT1368733	hsa-miR-4476	CLIP-seq
MIRT1368734	hsa-miR-4477b	CLIP-seq
MIRT1368735	hsa-miR-4478	CLIP-seq
MIRT1368737	hsa-miR-4514	CLIP-seq
MIRT1368738	hsa-miR-4516	CLIP-seq
MIRT1368739	hsa-miR-4518	CLIP-seq
MIRT2109606	hsa-miR-4522	CLIP-seq
MIRT1368740	hsa-miR-4525	CLIP-seq
MIRT1368741	hsa-miR-4645-5p	CLIP-seq
MIRT1368742	hsa-miR-4649-3p	CLIP-seq
MIRT1368743	hsa-miR-4651	CLIP-seq
MIRT1368744	hsa-miR-4659a-5p	CLIP-seq
MIRT1368745	hsa-miR-4659b-5p	CLIP-seq
MIRT1368746	hsa-miR-4662a-5p	CLIP-seq
MIRT1368747	hsa-miR-4664-5p	CLIP-seq
MIRT1368748	hsa-miR-4665-5p	CLIP-seq
MIRT1368749	hsa-miR-4673	CLIP-seq
MIRT2109607	hsa-miR-4680-3p	CLIP-seq
MIRT1368751	hsa-miR-4684-5p	CLIP-seq
MIRT1368752	hsa-miR-4690-3p	CLIP-seq
MIRT1368753	hsa-miR-4692	CLIP-seq
MIRT1368755	hsa-miR-4717-3p	CLIP-seq
MIRT2109608	hsa-miR-4717-5p	CLIP-seq
MIRT1368756	hsa-miR-4720-5p	CLIP-seq
MIRT1368758	hsa-miR-4723-5p	CLIP-seq
MIRT1368759	hsa-miR-4726-3p	CLIP-seq
MIRT1368760	hsa-miR-4728-5p	CLIP-seq
MIRT1368761	hsa-miR-4729	CLIP-seq
MIRT1368762	hsa-miR-4734	CLIP-seq
MIRT1368763	hsa-miR-4738-5p	CLIP-seq
MIRT1368764	hsa-miR-4762-3p	CLIP-seq
MIRT1368765	hsa-miR-4763-3p	CLIP-seq
MIRT1368766	hsa-miR-4764-5p	CLIP-seq
MIRT1368767	hsa-miR-4766-5p	CLIP-seq
MIRT1368768	hsa-miR-4769-3p	CLIP-seq
MIRT2109609	hsa-miR-4772-3p	CLIP-seq
MIRT1368769	hsa-miR-4772-5p	CLIP-seq
MIRT2109610	hsa-miR-4793-3p	CLIP-seq
MIRT1368770	hsa-miR-4799-3p	CLIP-seq
MIRT2109611	hsa-miR-509-3-5p	CLIP-seq
MIRT2109612	hsa-miR-509-5p	CLIP-seq
MIRT1368771	hsa-miR-544	CLIP-seq
MIRT1368772	hsa-miR-548c-3p	CLIP-seq
MIRT1368773	hsa-miR-561	CLIP-seq
MIRT1368774	hsa-miR-569	CLIP-seq
MIRT1368775	hsa-miR-579	CLIP-seq
MIRT1368776	hsa-miR-608	CLIP-seq
MIRT1368777	hsa-miR-613	CLIP-seq
MIRT1368778	hsa-miR-619	CLIP-seq
MIRT1368779	hsa-miR-625	CLIP-seq
MIRT1368781	hsa-miR-657	CLIP-seq
MIRT1368782	hsa-miR-660	CLIP-seq
MIRT1368783	hsa-miR-711	CLIP-seq
MIRT1368784	hsa-miR-759	CLIP-seq
MIRT1368785	hsa-miR-874	CLIP-seq
MIRT1368786	hsa-miR-876-3p	CLIP-seq
MIRT1368787	hsa-miR-939	CLIP-seq
MIRT1368788	hsa-miR-940	CLIP-seq
MIRT1368669	hsa-miR-1	CLIP-seq
MIRT1368670	hsa-miR-1184	CLIP-seq
MIRT1368671	hsa-miR-1205	CLIP-seq
MIRT1368672	hsa-miR-1207-5p	CLIP-seq
MIRT1368675	hsa-miR-1255a	CLIP-seq
MIRT1368676	hsa-miR-1255b	CLIP-seq
MIRT1368677	hsa-miR-1263	CLIP-seq
MIRT1368678	hsa-miR-1265	CLIP-seq
MIRT1368679	hsa-miR-1266	CLIP-seq
MIRT1368680	hsa-miR-1275	CLIP-seq
MIRT1368682	hsa-miR-146b-3p	CLIP-seq
MIRT1368683	hsa-miR-149	CLIP-seq
MIRT1368684	hsa-miR-181a	CLIP-seq
MIRT1368685	hsa-miR-181b	CLIP-seq
MIRT1368686	hsa-miR-181c	CLIP-seq
MIRT1368687	hsa-miR-181d	CLIP-seq
MIRT1368688	hsa-miR-1909	CLIP-seq
MIRT1368689	hsa-miR-1915	CLIP-seq
MIRT1368690	hsa-miR-194	CLIP-seq
MIRT1368692	hsa-miR-206	CLIP-seq
MIRT1368693	hsa-miR-2110	CLIP-seq
MIRT1368694	hsa-miR-2117	CLIP-seq
MIRT1368695	hsa-miR-2392	CLIP-seq
MIRT1368696	hsa-miR-24	CLIP-seq
MIRT1368697	hsa-miR-2964a-5p	CLIP-seq
MIRT1368698	hsa-miR-299-3p	CLIP-seq
MIRT2109600	hsa-miR-3064-3p	CLIP-seq
MIRT1368699	hsa-miR-3127-5p	CLIP-seq
MIRT1368700	hsa-miR-3148	CLIP-seq
MIRT1368701	hsa-miR-3150a-3p	CLIP-seq
MIRT1368702	hsa-miR-3158-5p	CLIP-seq
MIRT1368703	hsa-miR-3168	CLIP-seq
MIRT1368704	hsa-miR-3173-5p	CLIP-seq
MIRT1368705	hsa-miR-3175	CLIP-seq
MIRT1368706	hsa-miR-3202	CLIP-seq
MIRT1368707	hsa-miR-323-5p	CLIP-seq
MIRT1368708	hsa-miR-339-5p	CLIP-seq
MIRT1368709	hsa-miR-342-5p	CLIP-seq
MIRT1368710	hsa-miR-345	CLIP-seq
MIRT1368711	hsa-miR-3622b-5p	CLIP-seq
MIRT2109601	hsa-miR-3664-3p	CLIP-seq
MIRT1368712	hsa-miR-3665	CLIP-seq
MIRT1368713	hsa-miR-3673	CLIP-seq
MIRT1368714	hsa-miR-3688-5p	CLIP-seq
MIRT1368715	hsa-miR-3690	CLIP-seq
MIRT1368716	hsa-miR-383	CLIP-seq
MIRT1368717	hsa-miR-3914	CLIP-seq
MIRT1368719	hsa-miR-4256	CLIP-seq
MIRT1368721	hsa-miR-4262	CLIP-seq
MIRT1368722	hsa-miR-4270	CLIP-seq
MIRT1368723	hsa-miR-4277	CLIP-seq
MIRT1368724	hsa-miR-4281	CLIP-seq
MIRT1368725	hsa-miR-4284	CLIP-seq
MIRT1368726	hsa-miR-4290	CLIP-seq
MIRT1368727	hsa-miR-4308	CLIP-seq
MIRT1368730	hsa-miR-4441	CLIP-seq
MIRT1368731	hsa-miR-4470	CLIP-seq
MIRT1368732	hsa-miR-4475	CLIP-seq
MIRT1368733	hsa-miR-4476	CLIP-seq
MIRT1368737	hsa-miR-4514	CLIP-seq
MIRT1368739	hsa-miR-4518	CLIP-seq
MIRT1368740	hsa-miR-4525	CLIP-seq
MIRT1368741	hsa-miR-4645-5p	CLIP-seq
MIRT1368743	hsa-miR-4651	CLIP-seq
MIRT1368746	hsa-miR-4662a-5p	CLIP-seq
MIRT1368747	hsa-miR-4664-5p	CLIP-seq
MIRT1368748	hsa-miR-4665-5p	CLIP-seq
MIRT1368749	hsa-miR-4673	CLIP-seq
MIRT2109607	hsa-miR-4680-3p	CLIP-seq
MIRT1368750	hsa-miR-4681	CLIP-seq
MIRT1368751	hsa-miR-4684-5p	CLIP-seq
MIRT1368752	hsa-miR-4690-3p	CLIP-seq
MIRT1368753	hsa-miR-4692	CLIP-seq
MIRT1368755	hsa-miR-4717-3p	CLIP-seq
MIRT1368756	hsa-miR-4720-5p	CLIP-seq
MIRT1368758	hsa-miR-4723-5p	CLIP-seq
MIRT1368759	hsa-miR-4726-3p	CLIP-seq
MIRT1368760	hsa-miR-4728-5p	CLIP-seq
MIRT1368761	hsa-miR-4729	CLIP-seq
MIRT1368762	hsa-miR-4734	CLIP-seq
MIRT1368763	hsa-miR-4738-5p	CLIP-seq
MIRT1368764	hsa-miR-4762-3p	CLIP-seq
MIRT1368765	hsa-miR-4763-3p	CLIP-seq
MIRT1368766	hsa-miR-4764-5p	CLIP-seq
MIRT1368767	hsa-miR-4766-5p	CLIP-seq
MIRT1368769	hsa-miR-4772-5p	CLIP-seq
MIRT1368770	hsa-miR-4799-3p	CLIP-seq
MIRT1368771	hsa-miR-544	CLIP-seq
MIRT1368772	hsa-miR-548c-3p	CLIP-seq
MIRT1368773	hsa-miR-561	CLIP-seq
MIRT1368775	hsa-miR-579	CLIP-seq
MIRT1368776	hsa-miR-608	CLIP-seq
MIRT1368777	hsa-miR-613	CLIP-seq
MIRT1368778	hsa-miR-619	CLIP-seq
MIRT1368779	hsa-miR-625	CLIP-seq
MIRT1368781	hsa-miR-657	CLIP-seq
MIRT1368782	hsa-miR-660	CLIP-seq
MIRT1368783	hsa-miR-711	CLIP-seq
MIRT1368784	hsa-miR-759	CLIP-seq
MIRT1368785	hsa-miR-874	CLIP-seq
MIRT1368786	hsa-miR-876-3p	CLIP-seq
MIRT1368787	hsa-miR-939	CLIP-seq
MIRT1368788	hsa-miR-940	CLIP-seq
MIRT1368672	hsa-miR-1207-5p	CLIP-seq
MIRT1368682	hsa-miR-146b-3p	CLIP-seq
MIRT1368689	hsa-miR-1915	CLIP-seq
MIRT1368690	hsa-miR-194	CLIP-seq
MIRT1368704	hsa-miR-3173-5p	CLIP-seq
MIRT1368737	hsa-miR-4514	CLIP-seq
MIRT1368741	hsa-miR-4645-5p	CLIP-seq
MIRT1368749	hsa-miR-4673	CLIP-seq
MIRT1368753	hsa-miR-4692	CLIP-seq
MIRT1368755	hsa-miR-4717-3p	CLIP-seq
MIRT1368759	hsa-miR-4726-3p	CLIP-seq
MIRT1368765	hsa-miR-4763-3p	CLIP-seq
MIRT1368785	hsa-miR-874	CLIP-seq
MIRT1368788	hsa-miR-940	CLIP-seq
MIRT1368670	hsa-miR-1184	CLIP-seq
MIRT1368671	hsa-miR-1205	CLIP-seq
MIRT1368679	hsa-miR-1266	CLIP-seq
MIRT1368680	hsa-miR-1275	CLIP-seq
MIRT1368682	hsa-miR-146b-3p	CLIP-seq
MIRT1368690	hsa-miR-194	CLIP-seq
MIRT2109600	hsa-miR-3064-3p	CLIP-seq
MIRT1368702	hsa-miR-3158-5p	CLIP-seq
MIRT1368704	hsa-miR-3173-5p	CLIP-seq
MIRT1368706	hsa-miR-3202	CLIP-seq
MIRT1368708	hsa-miR-339-5p	CLIP-seq
MIRT2109601	hsa-miR-3664-3p	CLIP-seq
MIRT1368715	hsa-miR-3690	CLIP-seq
MIRT1368716	hsa-miR-383	CLIP-seq
MIRT1368723	hsa-miR-4277	CLIP-seq
MIRT1368727	hsa-miR-4308	CLIP-seq
MIRT1368733	hsa-miR-4476	CLIP-seq
MIRT1368739	hsa-miR-4518	CLIP-seq
MIRT1368740	hsa-miR-4525	CLIP-seq
MIRT1368748	hsa-miR-4665-5p	CLIP-seq
MIRT2109607	hsa-miR-4680-3p	CLIP-seq
MIRT1368752	hsa-miR-4690-3p	CLIP-seq
MIRT1368755	hsa-miR-4717-3p	CLIP-seq
MIRT1368758	hsa-miR-4723-5p	CLIP-seq
MIRT1368760	hsa-miR-4728-5p	CLIP-seq
MIRT1368761	hsa-miR-4729	CLIP-seq
MIRT1368764	hsa-miR-4762-3p	CLIP-seq
MIRT1368767	hsa-miR-4766-5p	CLIP-seq
MIRT1368769	hsa-miR-4772-5p	CLIP-seq
MIRT1368771	hsa-miR-544	CLIP-seq
MIRT1368779	hsa-miR-625	CLIP-seq
MIRT1368782	hsa-miR-660	CLIP-seq
MIRT1368783	hsa-miR-711	CLIP-seq
MIRT1368784	hsa-miR-759	CLIP-seq
MIRT1368785	hsa-miR-874	CLIP-seq
MIRT1368670	hsa-miR-1184	CLIP-seq
MIRT1368671	hsa-miR-1205	CLIP-seq
MIRT1368679	hsa-miR-1266	CLIP-seq
MIRT1368682	hsa-miR-146b-3p	CLIP-seq
MIRT1368690	hsa-miR-194	CLIP-seq
MIRT2109600	hsa-miR-3064-3p	CLIP-seq
MIRT1368702	hsa-miR-3158-5p	CLIP-seq
MIRT1368704	hsa-miR-3173-5p	CLIP-seq
MIRT1368708	hsa-miR-339-5p	CLIP-seq
MIRT2109601	hsa-miR-3664-3p	CLIP-seq
MIRT1368715	hsa-miR-3690	CLIP-seq
MIRT1368716	hsa-miR-383	CLIP-seq
MIRT1368723	hsa-miR-4277	CLIP-seq
MIRT1368727	hsa-miR-4308	CLIP-seq
MIRT1368739	hsa-miR-4518	CLIP-seq
MIRT1368752	hsa-miR-4690-3p	CLIP-seq
MIRT1368769	hsa-miR-4772-5p	CLIP-seq
MIRT1368771	hsa-miR-544	CLIP-seq
MIRT1368782	hsa-miR-660	CLIP-seq
MIRT1368783	hsa-miR-711	CLIP-seq
MIRT1368784	hsa-miR-759	CLIP-seq
MIRT1368785	hsa-miR-874	CLIP-seq

105

Show/Hide all (105)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001726	Component	Ruffle	IEA
GO:0002009	Process	Morphogenesis of an epithelium	NAS	25775275
GO:0003096	Process	Renal sodium ion transport	IEA
GO:0005102	Function	Signaling receptor binding	IBA
GO:0005102	Function	Signaling receptor binding	IPI	16456542
GO:0005515	Function	Protein binding	IPI	9430655, 9671706, 11285285, 12444019, 12471024, 15020681, 15523054, 16456542, 16615918, 17110338, 17242191, 17244609, 17895247, 17911601, 19027007, 19555689, 19615732, 20395446, 20442317, 20937695, 21804599, 22506049, 23397142, 23414517, 24012959, 26618866, 27880917, 28360110, 29568
GO:0005634	Component	Nucleus	IDA	17895247
GO:0005737	Component	Cytoplasm	IDA	17895247, 20736378
GO:0005737	Component	Cytoplasm	IEA
GO:0005886	Component	Plasma membrane	IEA
GO:0005902	Component	Microvillus	IDA	17242191
GO:0005902	Component	Microvillus	IEA
GO:0006814	Process	Sodium ion transport	IEA
GO:0007009	Process	Plasma membrane organization	IEA
GO:0007009	Process	Plasma membrane organization	ISS	25775275
GO:0007097	Process	Nuclear migration	IMP	24862762
GO:0007191	Process	Adenylate cyclase-activating dopamine receptor signaling pathway	IEA
GO:0007605	Process	Sensory perception of sound	IEA
GO:0008013	Function	Beta-catenin binding	IEA
GO:0008013	Function	Beta-catenin binding	IPI	17242191
GO:0008104	Process	Intracellular protein localization	IEA
GO:0008285	Process	Negative regulation of cell population proliferation	IDA	20012548
GO:0008285	Process	Negative regulation of cell population proliferation	IMP	20736378
GO:0008360	Process	Regulation of cell shape	IMP	24862762
GO:0008361	Process	Regulation of cell size	IMP	24862762
GO:0010642	Process	Negative regulation of platelet-derived growth factor receptor signaling pathway	IEA
GO:0010642	Process	Negative regulation of platelet-derived growth factor receptor signaling pathway	ISS
GO:0010761	Process	Fibroblast migration	IEA
GO:0010764	Process	Negative regulation of fibroblast migration	IEA
GO:0010766	Process	Negative regulation of sodium ion transport	IEA
GO:0012505	Component	Endomembrane system	IEA
GO:0015185	Function	Gamma-aminobutyric acid transmembrane transporter activity	ISS
GO:0015629	Component	Actin cytoskeleton	TAS	9430655
GO:0016020	Component	Membrane	IDA	20736378
GO:0016020	Component	Membrane	IEA
GO:0016055	Process	Wnt signaling pathway	IEA
GO:0016324	Component	Apical plasma membrane	IBA
GO:0016324	Component	Apical plasma membrane	IDA	22855531, 24862762, 25775275
GO:0016324	Component	Apical plasma membrane	IEA
GO:0017081	Function	Chloride channel regulator activity	IDA	12881487
GO:0019902	Function	Phosphatase binding	IEA
GO:0019902	Function	Phosphatase binding	IPI	16456542
GO:0022612	Process	Gland morphogenesis	IMP	24862762
GO:0030033	Process	Microvillus assembly	IMP	20937695
GO:0030036	Process	Actin cytoskeleton organization	IEA
GO:0030165	Function	PDZ domain binding	IPI	16236806
GO:0030175	Component	Filopodium	IEA
GO:0030643	Process	Intracellular phosphate ion homeostasis	IEA
GO:0031526	Component	Brush border membrane	IEA
GO:0031528	Component	Microvillus membrane	ISS
GO:0031698	Function	Beta-2 adrenergic receptor binding	IPI	9560162
GO:0031799	Function	Type 2 metabotropic glutamate receptor binding	IPI	28392297
GO:0031800	Function	Type 3 metabotropic glutamate receptor binding	IPI	28392297
GO:0031982	Component	Vesicle	HDA	19190083
GO:0032420	Component	Stereocilium	IEA
GO:0032426	Component	Stereocilium tip	IEA
GO:0032782	Process	Bile acid secretion	IEA
GO:0032782	Process	Bile acid secretion	ISS
GO:0034635	Process	Glutathione transport	IEA
GO:0034635	Process	Glutathione transport	ISS
GO:0042802	Function	Identical protein binding	IPI	19446522, 34189428
GO:0042995	Component	Cell projection	IEA
GO:0043495	Function	Protein-membrane adaptor activity	IBA
GO:0044782	Process	Cilium organization	IEA
GO:0044782	Process	Cilium organization	ISS	25775275
GO:0045177	Component	Apical part of cell	IEA
GO:0045198	Process	Establishment of epithelial cell apical/basal polarity	IMP	24862762
GO:0045199	Process	Maintenance of epithelial cell apical/basal polarity	IEA
GO:0045199	Process	Maintenance of epithelial cell apical/basal polarity	IMP	25775275
GO:0045199	Process	Maintenance of epithelial cell apical/basal polarity	ISS	25775275
GO:0045859	Process	Regulation of protein kinase activity	ISS
GO:0045930	Process	Negative regulation of mitotic cell cycle	IMP	24862762
GO:0048471	Component	Perinuclear region of cytoplasm	IDA	24862762
GO:0050780	Function	Dopamine receptor binding	IEA
GO:0051649	Process	Establishment of localization in cell	IEA
GO:0051683	Process	Establishment of Golgi localization	IMP	24862762
GO:0051898	Process	Negative regulation of phosphatidylinositol 3-kinase/protein kinase B signal transduction	IEA
GO:0051898	Process	Negative regulation of phosphatidylinositol 3-kinase/protein kinase B signal transduction	IMP	20736378
GO:0051898	Process	Negative regulation of phosphatidylinositol 3-kinase/protein kinase B signal transduction	ISS
GO:0051939	Process	Gamma-aminobutyric acid import	ISS
GO:0060088	Process	Auditory receptor cell stereocilium organization	IEA
GO:0060090	Function	Molecular adaptor activity	IEA
GO:0060158	Process	Phospholipase C-activating dopamine receptor signaling pathway	IEA
GO:0065003	Process	Protein-containing complex assembly	TAS	9430655
GO:0070062	Component	Extracellular exosome	HDA	19056867, 19199708, 20458337, 23533145
GO:0070293	Process	Renal absorption	IEA
GO:0070293	Process	Renal absorption	ISS
GO:0070373	Process	Negative regulation of ERK1 and ERK2 cascade	IDA	20012548
GO:0070851	Function	Growth factor receptor binding	IPI	17242191
GO:0071944	Component	Cell periphery	IDA	17895247
GO:0072659	Process	Protein localization to plasma membrane	IBA
GO:0072659	Process	Protein localization to plasma membrane	IMP	24862762
GO:0090090	Process	Negative regulation of canonical Wnt signaling pathway	IMP	24862762
GO:0090660	Process	Cerebrospinal fluid circulation	IEA
GO:0090660	Process	Cerebrospinal fluid circulation	ISS	25775275, 28392297
GO:0097225	Component	Sperm midpiece	IEA
GO:0097225	Component	Sperm midpiece	ISS
GO:0097291	Process	Renal phosphate ion absorption	IMP	18784102
GO:0098739	Process	Import across plasma membrane	ISS
GO:0098797	Component	Plasma membrane protein complex	ISS
GO:0099103	Function	Channel activator activity	IDA	9560162
GO:0150104	Process	Transport across blood-brain barrier	NAS	30280653
GO:1903402	Process	Regulation of renal phosphate excretion	IEA
GO:2000146	Process	Negative regulation of cell motility	IEA
GO:2001244	Process	Positive regulation of intrinsic apoptotic signaling pathway	IDA	20012548

MIM	HGNC	e!Ensembl
604990	11075	ENSG00000109062

O14745

Protein name

Na(+)/H(+) exchange regulatory cofactor NHE-RF1 (NHERF-1) (Ezrin-radixin-moesin-binding phosphoprotein 50) (EBP50) (Regulatory cofactor of Na(+)/H(+) exchanger) (Sodium-hydrogen exchanger regulatory factor 1) (Solute carrier family 9 isoform A3 regulatory

Protein function

Scaffold protein that connects plasma membrane proteins with members of the ezrin/moesin/radixin family and thereby helps to link them to the actin cytoskeleton and to regulate their surface expression. Necessary for recycling of internalized AD

PDB

1G9O , 1GQ4 , 1GQ5 , 1I92 , 1SGH , 2D10 , 2JXO , 2KJD , 2KRG , 2M0T , 2M0U , 2M0V , 2OZF , 4JL7 , 4LMM , 4MPA , 4N6X , 4PQW , 4Q3H , 6RQR

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF17820	PDZ_6	38 → 92	PDZ domain	Domain
PF00595	PDZ	154 → 231	PDZ domain	Domain
PF09007	EBP50_C	235 → 358	EBP50, C-terminal	Domain

Tissue specificity

TISSUE SPECIFICITY: Detected in liver, kidney, pancreas, prostate, spleen, small intestine and placenta, in particular in the syncytiotrophoblast. {ECO:0000269|PubMed:9096337, ECO:0000269|PubMed:9314537}.

Sequence

MSADAAAGAPLPRLCCLEKGPNGYGFHLHGEKGKLGQYIRLVEPGSPAEKAGLLAGDRLV
EVNGENVEKETHQQVVSRIRAALNAVRLLVVDPETDEQLQKLGVQVREELLRAQEAPGQA
EPPAAAEVQGAGNENEPREADKSHPEQRELRPRLCTMKKGPSGYGFNLHSDKSKPGQFIR
SVDPDSPAEASGLRAQDRIVEVNGVCMEGKQHGDVVSAIRAGGDETKLLVVDRETDEFFK
KCRVIPSQEHLNGPLPVPFTNGEIQKENSREALAEAALESPRPALVRSASSDTSEELNSQ
DSPPKQDSTAPSSTSSSDPILDFNISLAMAKERAHQKRSSKRAPQMDWSKKNELFSNL

Sequence length

358

Interactions

View interactions

	KEGG
	Tight junction Parathyroid hormone synthesis, secretion and action Pathogenic Escherichia coli infection Human papillomavirus infection

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (16)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
CARCINOMA, DUCTAL, BREAST	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Chronic kidney disease	Conflicting classifications of pathogenicity	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CHRONIC KIDNEY DISEASES	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Clear cell carcinoma of kidney	Conflicting classifications of pathogenicity	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DOMINANT HYPOPHOSPHATEMIA WITH NEPHROLITHIASIS AND/OR OSTEOPOROSIS	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Dominant hypophosphatemia with nephrolithiasis or osteoporosis	Benign; Likely benign; Uncertain significance; Conflicting classifications of pathogenicity	ClinVar ClinVar, Orphanet ClinVar, Orphanet	★★★★★ ★★★☆☆ Reported in Unknown/Other Associations (≥2 sources)
Familial cancer of breast	Conflicting classifications of pathogenicity	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hypophosphatemia	Benign; Likely benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hypophosphatemic nephrolithiasis/osteoporosis 2	Uncertain significance; Conflicting classifications of pathogenicity; Likely benign; Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Malignant tumor of urinary bladder	Conflicting classifications of pathogenicity	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Nephrolithiasis	Benign; Likely benign	ClinVar Disgenet	★★★★★ ★★★☆☆ Reported in Unknown/Other Associations (≥2 sources)
NEPHROLITHIASIS-OSTEOPOROSIS, HYPOPHOSPHATEMIC, 2	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
NEPHROLITHIASIS/OSTEOPOROSIS, HYPOPHOSPHATEMIC, 2	—	CTD, HPO CTD, HPO	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
NHERF1-related disorder	Conflicting classifications of pathogenicity; Benign; Likely benign; Uncertain significance	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Ovarian serous cystadenocarcinoma	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Uterine corpus endometrial carcinoma	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (110)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Acute Promyelocytic Leukemia	Promyelocytic Leukemia	BEFREE	31254567		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of pancreas	Pancreatic adenocarcinoma	BEFREE	29725468		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenoma	Adenoma	BEFREE	29551770		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenoma of large intestine	Colorectal adenoma	BEFREE	21170265		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adult Hepatocellular Carcinoma	Liver carcinoma	BEFREE	23483729		★★★★★ ★☆☆☆☆ Found in Text Mining only
Anaplastic Ependymoma	Anaplastic Ependymoma	BEFREE	25775275		★★★★★ ★☆☆☆☆ Found in Text Mining only
Biliary Tract Cancer	Biliary Tract Cancer	BEFREE	21822312		★★★★★ ★☆☆☆☆ Found in Text Mining only
Bone Diseases	Bone disease	Pubtator	17900349	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Brain Neoplasms	Brain Neoplasms	BEFREE	25775275		★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Cancer, Familial	Breast Cancer	BEFREE	21285147		★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	15467753, 17078868, 17593079, 20012548, 20802536, 22476347, 24012959, 24201803, 26977012, 27097111, 28011475, 28739728, 29029467, 29283175, 29455084, 29716631, 30326259, 31087002 View all (3 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	11141479, 17332506, 22439624, 24201803, 26312763, 27097111, 27448983, 29716631, 32164629, 40429857	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	22476347, 26218645	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinogenesis	Carcinogenesis	Pubtator	21672215, 27448983	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma of lung	Lung carcinoma	BEFREE	28739734		★★★★★ ★☆☆☆☆ Found in Text Mining only
Central Nervous System Neoplasms	Central nervous system neoplasm	Pubtator	27229317	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
cervical cancer	Cervical Cancer	BEFREE	28085111, 28739728, 29867145		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cervix carcinoma	Cervix carcinoma	BEFREE	28085111, 28739728, 29867145		★★★★★ ★☆☆☆☆ Found in Text Mining only
Childhood Hepatocellular Carcinoma	Liver carcinoma	BEFREE	23483729		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cholangiocarcinoma	Cholangiocarcinoma	Pubtator	22446018	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cholangiocarcinoma	Cholangiocarcinoma	BEFREE	27509846, 28454463		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cholecystitis	Cholecystitis	BEFREE	28454463		★★★★★ ★☆☆☆☆ Found in Text Mining only
Chondrosarcoma	Chondrosarcoma	BEFREE	29983887		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colitis	Colitis	BEFREE	18942765, 25271043		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colon Carcinoma	Colon Carcinoma	BEFREE	29901158		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	21170265, 24348097, 27566107, 27765918, 27999191, 29520890, 29551770, 29901158		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	21170265, 23991686, 24348097, 27765918, 27999191, 29520890, 29551770	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal Neoplasms	BEFREE	22466651		★★★★★ ★☆☆☆☆ Found in Text Mining only
Communicating Hydrocephalus	Communicating Hydrocephalus	BEFREE	25775275		★★★★★ ★☆☆☆☆ Found in Text Mining only
Conventional (Clear Cell) Renal Cell Carcinoma	Renal Carcinoma	BEFREE	20395446		★★★★★ ★☆☆☆☆ Found in Text Mining only
Crohn Disease	Crohn Disease	BEFREE	20031577		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cystic Disease Of Lung	Cystic lung disease	Pubtator	26140448	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cystic Fibrosis	Cystic Fibrosis	LHGDN	11956211, 12651858		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cystic Fibrosis	Cystic Fibrosis	BEFREE	21983488, 23785472, 26140448		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cystic Fibrosis	Cystic fibrosis	Pubtator	21983488, 22964850	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Dermatitis Atopic	Atopic dermatitis	Pubtator	16374479	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Dermatitis, Atopic	Dermatitis	BEFREE	16374479		★★★★★ ★☆☆☆☆ Found in Text Mining only
Dominant hypophosphatemia with nephrolithiasis or osteoporosis	Hypophosphatemia With Nephrolithiasis Or Osteoporosis	Orphanet			★★★★★ ★★★☆☆ Reported in Unknown/Other Associations (≥2 sources)
Eczema	Eczema	BEFREE	16374479		★★★★★ ★☆☆☆☆ Found in Text Mining only
Endometrial Neoplasms	Endometrial neoplasm	Pubtator	39971177	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Ependymoma	Ependymoma	BEFREE	25775275, 27753657		★★★★★ ★☆☆☆☆ Found in Text Mining only
Esophageal Squamous Cell Carcinoma	Esophageal squamous cell carcinoma	Pubtator	25555876	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	BEFREE	19308292, 20736378, 27753657		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	Pubtator	19308292, 21804599	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma Multiforme	Glioblastoma	BEFREE	19308292, 20736378, 27753657		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	BEFREE	19308292, 31711240		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	Pubtator	19308292	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hydrocephalus	Hydrocephalus	BEFREE	28392297		★★★★★ ★☆☆☆☆ Found in Text Mining only
HYDROCEPHALUS, NONSYNDROMIC, AUTOSOMAL RECESSIVE 1	Hydrocephalus	BEFREE	28392297		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypertensive disease	Hypertension	BEFREE	28515088		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypophosphatemic Rickets, X-Linked Dominant	Hypophosphatemic Rickets	BEFREE	29126251		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypoxia	Hypoxia	Pubtator	17332506	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypoxia	Hypoxia	Pubtator	27999191	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Inflammatory Bowel Diseases	Inflammatory Bowel Disease	BEFREE	18942765		★★★★★ ★☆☆☆☆ Found in Text Mining only
Inflammatory Breast Carcinoma	Breast Cancer	BEFREE	27448983		★★★★★ ★☆☆☆☆ Found in Text Mining only
Invasive Ductal Breast Carcinoma	Invasive Duct and Lobular Carcinoma	CTD_human_DG	28235801		★★★★★ ★☆☆☆☆ Found in Text Mining only
Irritable Bowel Syndrome	Irritable Bowel Syndrome	BEFREE	18942765		★★★★★ ★☆☆☆☆ Found in Text Mining only
Kidney Failure, Acute	Kidney Failure	BEFREE	30926337		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	12830000, 23483729		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver neoplasms	Liver neoplasms	LHGDN	12830000		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lung diseases	Lung Diseases	BEFREE	26140448		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung neoplasms	Pubtator	28739734	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic metastasis	Pubtator	25555876	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Glioma	Glioma	BEFREE	19308292		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	15467753, 17078868, 17593079, 20012548, 20802536, 21203899, 22476347, 24012959, 24201803, 26977012, 27097111, 28011475, 28235801, 28739728, 29029467 View all (5 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of kidney	Kidney Cancer	BEFREE	26142394		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of liver	Liver Cancer	BEFREE	12830000, 18781953, 23483729, 30581004		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of lung	Lung Cancer	BEFREE	28739734		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of pancreas	Pancreatic cancer	BEFREE	22622406		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	18781953, 22622406, 24201803, 24348097, 25775275, 27566107, 28011475, 28068322, 28684865, 29283175, 29455084		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant tumor of cervix	Cervical Tumor	BEFREE	28085111, 28739728, 29867145		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant tumor of colon	Colonic Neoplasms	BEFREE	29901158		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mammary Ductal Carcinoma	Marfan Syndrome	CTD_human_DG	28235801		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	BEFREE	15467753, 17078868, 20802536, 26977012		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	LHGDN	17332506, 17593079		★★★★★ ★☆☆☆☆ Found in Text Mining only
melanoma	Melanoma	BEFREE	25897829		★★★★★ ★☆☆☆☆ Found in Text Mining only
Meningioma	Meningioma	BEFREE	27753657, 29983887		★★★★★ ★☆☆☆☆ Found in Text Mining only
Myxopapillary ependymoma	Myxopapillary Ependymoma	BEFREE	27753657		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	17078868, 17593079, 18781953, 19308292, 20012548, 20736378, 21203899, 22622406, 23483729, 24012959, 24201803, 25756512, 26867566, 27509846, 27566107 View all (9 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Nephrolithiasis	Nephrolithiasis	Pubtator	28893421	Associate	★★★★★ ★★★☆☆ Reported in Unknown/Other Associations (≥2 sources)
Nephrolithiasis	Nephrolithiasis	HPO_DG			★★★★★ ★★★☆☆ Reported in Unknown/Other Associations (≥2 sources)
Nephrolithiasis-Osteoporosis, Hypophosphatemic, 2	Nephrolithiasis-Osteoporosis, Hypophosphatemic	GENOMICS_ENGLAND_DG	18784102, 19073985		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Nephrolithiasis-Osteoporosis, Hypophosphatemic, 2	Nephrolithiasis-Osteoporosis, Hypophosphatemic	UNIPROT_DG	18784102, 22506049		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Nephrolithiasis-Osteoporosis, Hypophosphatemic, 2	Nephrolithiasis-Osteoporosis, Hypophosphatemic	CLINVAR_DG			★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Nephrolithiasis-Osteoporosis, Hypophosphatemic, 2	Nephrolithiasis-Osteoporosis, Hypophosphatemic	CTD_human_DG			★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Noninfiltrating Intraductal Carcinoma	Ductal carcinoma	BEFREE	28235801		★★★★★ ★☆☆☆☆ Found in Text Mining only
Oestrogen receptor positive breast cancer	Oestrogen Receptor Positive Breast Cancer	BEFREE	21203899, 27448983		★★★★★ ★☆☆☆☆ Found in Text Mining only
Oropharyngeal Neoplasms	Oropharyngeal neoplasm	Pubtator	29846905	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteoarthritis	Osteoarthritis	Pubtator	17900349	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteopenia	Osteopenia	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteoporosis	Osteoporosis	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteosarcoma	Osteosarcoma	BEFREE	18202147, 22028271		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Ovarian neoplasm	Pubtator	28684865	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatic carcinoma	Pancreatic carcinoma	BEFREE	22622406		★★★★★ ★☆☆☆☆ Found in Text Mining only
Papilloma Choroid Plexus	Choroid plexus papilloma	Pubtator	27229317	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Phosphate Diabetes	Phosphate Diabetes	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Polycystic Kidney, Autosomal Dominant	Polycystic kidney disease	BEFREE	26142394		★★★★★ ★☆☆☆☆ Found in Text Mining only
Primary sclerosing cholangitis	Sclerosing Cholangitis	BEFREE	19234136		★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostatic Intraepithelial Neoplasia	Prostatic intraepithelial neoplasia	Pubtator	21672215	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	21672215	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Psoriasis	Psoriasis	BEFREE	14608357, 20031577, 21166663		★★★★★ ★☆☆☆☆ Found in Text Mining only
Psoriasis	Psoriasis	LHGDN	14608357		★★★★★ ★☆☆☆☆ Found in Text Mining only
Psoriasis	Psoriasis	Pubtator	16519819, 20031577	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Renal carcinoma	Renal Carcinoma	BEFREE	26142394		★★★★★ ★☆☆☆☆ Found in Text Mining only
Renal Cell Carcinoma	Renal Carcinoma	BEFREE	20395446		★★★★★ ★☆☆☆☆ Found in Text Mining only
Schizophrenia	Schizophrenia	LHGDN	19034380, 19165527		★★★★★ ★☆☆☆☆ Found in Text Mining only
Secretory meningioma	Secretory Meningioma	BEFREE	29983887		★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	26126066	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Triple Negative Breast Neoplasms	Triple Negative Breast Neoplasms	BEFREE	25530180, 28535016		★★★★★ ★☆☆☆☆ Found in Text Mining only
Uterine Cervical Neoplasms	Uterine neoplasm	Pubtator	28085111	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only

NHERF1 (NHERF family PDZ scaffold protein 1)