Gene Gene information from NCBI Gene database.
Entrez ID 93627
Gene name TBC1 domain containing kinase
Gene symbol TBCK
Synonyms (NCBI Gene)
FERRY1Fy-1HSPC302IHPRF3TBCKL
Chromosome 4
Chromosome location 4q24
Summary This gene encodes a protein that contains a protein kinase domain, a Rhodanase-like domain and the Tre-2/Bub2/Cdc16 (TBC) domain. The encoded protein is thought to play a role in actin organization, cell growth and cell proliferation by regulating the mam
SNPs SNP information provided by dbSNP.
23
SNP ID Visualize variation Clinical significance Consequence
rs34840340 T>A,C Conflicting-interpretations-of-pathogenicity Missense variant, coding sequence variant, non coding transcript variant
rs62321379 T>C Likely-pathogenic Splice acceptor variant
rs374319146 C>A,T Likely-pathogenic, pathogenic Intron variant, splice donor variant
rs376699648 T>A Pathogenic, likely-pathogenic Coding sequence variant, stop gained, non coding transcript variant
rs575822089 G>A Pathogenic, likely-pathogenic Intron variant, non coding transcript variant, coding sequence variant, 5 prime UTR variant, stop gained, genic upstream transcript variant
miRNA miRNA information provided by mirtarbase database.
221
miRTarBase ID miRNA Experiments Reference
MIRT018768 hsa-miR-335-5p Microarray 18185580
MIRT611773 hsa-miR-8485 HITS-CLIP 23824327
MIRT611772 hsa-miR-329-3p HITS-CLIP 23824327
MIRT611771 hsa-miR-362-3p HITS-CLIP 23824327
MIRT611770 hsa-miR-603 HITS-CLIP 23824327
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
19
GO ID Ontology Definition Evidence Reference
GO:0004672 Function Protein kinase activity IEA
GO:0004672 Function Protein kinase activity NAS 12471243
GO:0005096 Function GTPase activator activity IBA
GO:0005515 Function Protein binding IPI 26496610, 37267906
GO:0005524 Function ATP binding IEA
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
MIM HGNC e!Ensembl
616899 28261 ENSG00000145348
Protein Protein information from UniProt database.
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q8TEA7
Protein name TBC domain-containing protein kinase-like protein (FERRY endosomal RAB5 effector complex subunit 1) (Fy-1)
Protein function Component of the FERRY complex (Five-subunit Endosomal Rab5 and RNA/ribosome intermediary) (PubMed:37267905). The FERRY complex directly interacts with mRNAs and RAB5A, and functions as a RAB5A effector involved in the localization and the distr
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00069 Pkinase 32 273 Protein kinase domain Domain
PF00566 RabGAP-TBC 470 671 Rab-GTPase-TBC domain Family
PF00581 Rhodanese 784 883 Rhodanese-like domain Domain
Sequence
MFPLKDAEMGAFTFFASALPHDVCGSNGLPLTPNSIKILGRFQILKTITHPRLCQYVDIS
RGKHERLVVVAEHCERSLEDLLRERKPVSCSTVLCIAFEVLQGLQYMNKHGIVHRALSPH
NILLDRKGHIKLAKFGLYHMTAHGDDVDFPIGYPSYLAPEVIAQGIFKTTDHMPSKKPLP
SGPKSDVWSLGIILFELCVGRKLFQSLDISERLKFLLTLDCVDDTLIVLAEEHGCLDIIK
ELPETVIDLLNKCLTFHPSKRPTPDQLMKDKVF
SEVSPLYTPFTKPASLFSSSLRCADLT
LPEDISQLCKDINNDYLAERSIEEVYYLWCLAGGDLEKELVNKEIIRSKPPICTLPNFLF
EDGESFGQGRDRSSLLDDTTVTLSLCQLRNRLKDVGGEAFYPLLEDDQSNLPHSNSNNEL
SAAATLPLIIREKDTEYQLNRIILFDRLLKAYPYKKNQIWKEARVDIPPLMRGLTWAALL
GVEGAIHAKYDAIDKDTPIPTDRQIEVDIPRCHQYDELLSSPEGHAKFRRVLKAWVVSHP
DLVYWQGLDSLCAPFLYLNFNNEALAYACMSAFIPKYLYNFFLKDNSHVIQEYLTVFSQM
IAFHDPELSNHLNEIGFIPDLYAIPWFLTMFTHVFPLHKIFHLWDTLLLGNSSFPFCIGV
AILQQLRDRLL
ANGFNECILLFSDLPEIDIERCVRESINLFCWTPKSATYRQHAQPPKPS
SDSSGGRSSAPYFSAECPDPPKTDLSRESIPLNDLKSEVSPRISAEDLIDLCELTVTGHF
KTPSKKTKSSKPKLLVVDIRNSEDFIRGHISGSINIPFSAAFTAEGELTQGPYTAMLQNF
KGKVIVIVGHVAKHTAEFAAHLVKMKYPRICILDGGINKIKPT
GLLTIPSPQI
Sequence length 893
Interactions View interactions
Associated diseases Disease associations from ClinVar (causal & non-causal) and other databases (OMIM, Orphanet, GWAS, etc.).
24
Evidence Score: ★☆☆☆☆  Gene-disease association found in Text Mining only ★★☆☆☆  Found in Text Mining and Unknown/Other Associations ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)
Causal Diseases associated with Pathogenic or Likely Pathogenic variants in ClinVar
Phenotype Name Clinical Significance dbSNP ID RCV Accession Evidence Score
Abnormality of the nervous system Likely pathogenic; Pathogenic rs763057505, rs374319146 RCV001814557
RCV001814075
★★★★☆
ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Colon adenocarcinoma Pathogenic rs374319146 RCV005888593
★★★★☆
ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Global developmental delay Pathogenic rs762552974 RCV001775126
★★★★☆
ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Hypotonia, infantile, with psychomotor retardation and characteristic facies 1 Pathogenic rs771481304 RCV005625451
★★★★☆
ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
Phenotype Name Clinical Significance Source Evidence Score
Acute myeloid leukemia Benign ClinVar
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
Adrenocortical carcinoma, hereditary Benign ClinVar
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
CONGENITAL NEUROLOGIC ANOMALIES Disgenet
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
Familial cancer of breast Benign ClinVar
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
Associations from Text Mining Disease associations identified through text mining
Disease Name Disease (Merged) Source PMID Relationship Type Evidence Score
Adenocarcinoma of large intestine Colorectal Cancer UNIPROT_DG
★☆☆☆☆
Found in Text Mining only
Angiofibroma Angiofibroma BEFREE 27633981
★☆☆☆☆
Found in Text Mining only
Blepharoptosis Ptosis CLINVAR_DG
★☆☆☆☆
Found in Text Mining only
Brain atrophy Brain atrophy HPO_DG
★☆☆☆☆
Found in Text Mining only
Brain Diseases Brain disease Pubtator 27040692, 29283439, 33001864 Associate
★☆☆☆☆
Found in Text Mining only
Byzanthine arch palate High palate CLINVAR_DG
★☆☆☆☆
Found in Text Mining only
Central visual impairment Central Visual Impairment HPO_DG
★☆☆☆☆
Found in Text Mining only
Cerebellar Hypoplasia Cerebellar Hypoplasia HPO_DG
★☆☆☆☆
Found in Text Mining only
Cerebral atrophy Cerebral Atrophy HPO_DG
★☆☆☆☆
Found in Text Mining only
Cognition Disorders Cognition disorder Pubtator 32363625 Associate
★☆☆☆☆
Found in Text Mining only