Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	9356
Gene name	Solute carrier family 22 member 6
Gene symbol	SLC22A6
Synonyms (NCBI Gene)	HOAT1OAT1PAHTROAT1
Chromosome	11
Chromosome location	11q12.3
Summary	The protein encoded by this gene is involved in the sodium-dependent transport and excretion of organic anions, some of which are potentially toxic. The encoded protein is an integral membrane protein and may be localized to the basolateral membrane. Four

Show/Hide all (66)

miRTarBase ID	miRNA	Experiments	Reference
MIRT646399	hsa-miR-296-3p	HITS-CLIP	23824327
MIRT646398	hsa-miR-1470	HITS-CLIP	23824327
MIRT646397	hsa-miR-4667-3p	HITS-CLIP	23824327
MIRT646396	hsa-miR-6832-3p	HITS-CLIP	23824327
MIRT646395	hsa-miR-6734-3p	HITS-CLIP	23824327
MIRT646393	hsa-miR-4287	HITS-CLIP	23824327
MIRT646394	hsa-miR-4685-3p	HITS-CLIP	23824327
MIRT646392	hsa-miR-659-5p	HITS-CLIP	23824327
MIRT646391	hsa-miR-8065	HITS-CLIP	23824327
MIRT646390	hsa-miR-642a-5p	HITS-CLIP	23824327
MIRT646389	hsa-miR-204-5p	HITS-CLIP	23824327
MIRT646388	hsa-miR-211-5p	HITS-CLIP	23824327
MIRT646387	hsa-miR-2909	HITS-CLIP	23824327
MIRT646386	hsa-miR-5193	HITS-CLIP	23824327
MIRT646385	hsa-miR-660-3p	HITS-CLIP	23824327
MIRT646384	hsa-miR-877-3p	HITS-CLIP	23824327
MIRT646383	hsa-miR-1236-3p	HITS-CLIP	23824327
MIRT646382	hsa-miR-581	HITS-CLIP	23824327
MIRT646381	hsa-miR-6748-5p	HITS-CLIP	23824327
MIRT646380	hsa-miR-6793-5p	HITS-CLIP	23824327
MIRT646379	hsa-miR-3911	HITS-CLIP	23824327
MIRT646378	hsa-miR-644a	HITS-CLIP	23824327
MIRT646377	hsa-miR-4691-5p	HITS-CLIP	23824327
MIRT646376	hsa-miR-6792-3p	HITS-CLIP	23824327
MIRT646375	hsa-miR-6749-3p	HITS-CLIP	23824327
MIRT646374	hsa-miR-7111-3p	HITS-CLIP	23824327
MIRT646373	hsa-miR-6780a-3p	HITS-CLIP	23824327
MIRT646372	hsa-miR-6881-3p	HITS-CLIP	23824327
MIRT646371	hsa-miR-6759-5p	HITS-CLIP	23824327
MIRT646370	hsa-miR-6818-5p	HITS-CLIP	23824327
MIRT646369	hsa-miR-147a	HITS-CLIP	23824327
MIRT646368	hsa-miR-670-3p	HITS-CLIP	23824327
MIRT646367	hsa-miR-1238-3p	HITS-CLIP	23824327
MIRT646399	hsa-miR-296-3p	HITS-CLIP	23824327
MIRT646398	hsa-miR-1470	HITS-CLIP	23824327
MIRT646397	hsa-miR-4667-3p	HITS-CLIP	23824327
MIRT646396	hsa-miR-6832-3p	HITS-CLIP	23824327
MIRT646395	hsa-miR-6734-3p	HITS-CLIP	23824327
MIRT646393	hsa-miR-4287	HITS-CLIP	23824327
MIRT646394	hsa-miR-4685-3p	HITS-CLIP	23824327
MIRT646392	hsa-miR-659-5p	HITS-CLIP	23824327
MIRT646391	hsa-miR-8065	HITS-CLIP	23824327
MIRT646390	hsa-miR-642a-5p	HITS-CLIP	23824327
MIRT646389	hsa-miR-204-5p	HITS-CLIP	23824327
MIRT646388	hsa-miR-211-5p	HITS-CLIP	23824327
MIRT646387	hsa-miR-2909	HITS-CLIP	23824327
MIRT646386	hsa-miR-5193	HITS-CLIP	23824327
MIRT646385	hsa-miR-660-3p	HITS-CLIP	23824327
MIRT646384	hsa-miR-877-3p	HITS-CLIP	23824327
MIRT646383	hsa-miR-1236-3p	HITS-CLIP	23824327
MIRT646382	hsa-miR-581	HITS-CLIP	23824327
MIRT646381	hsa-miR-6748-5p	HITS-CLIP	23824327
MIRT646380	hsa-miR-6793-5p	HITS-CLIP	23824327
MIRT646379	hsa-miR-3911	HITS-CLIP	23824327
MIRT646378	hsa-miR-644a	HITS-CLIP	23824327
MIRT646377	hsa-miR-4691-5p	HITS-CLIP	23824327
MIRT646376	hsa-miR-6792-3p	HITS-CLIP	23824327
MIRT646375	hsa-miR-6749-3p	HITS-CLIP	23824327
MIRT646374	hsa-miR-7111-3p	HITS-CLIP	23824327
MIRT646373	hsa-miR-6780a-3p	HITS-CLIP	23824327
MIRT646372	hsa-miR-6881-3p	HITS-CLIP	23824327
MIRT646371	hsa-miR-6759-5p	HITS-CLIP	23824327
MIRT646370	hsa-miR-6818-5p	HITS-CLIP	23824327
MIRT646369	hsa-miR-147a	HITS-CLIP	23824327
MIRT646368	hsa-miR-670-3p	HITS-CLIP	23824327
MIRT646367	hsa-miR-1238-3p	HITS-CLIP	23824327

Show/Hide all (1)

Transcription factor	Regulation	Reference
HNF4A	Unknown	17344191

Show/Hide all (48)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005452	Function	Solute:inorganic anion antiporter activity	IDA	15037815
GO:0005515	Function	Protein binding	IPI	16189514, 19060904
GO:0005886	Component	Plasma membrane	IDA	14749323
GO:0005886	Component	Plasma membrane	IEA
GO:0005886	Component	Plasma membrane	TAS
GO:0005901	Component	Caveola	IEA
GO:0006820	Process	Monoatomic anion transport	IEA
GO:0008514	Function	Organic anion transmembrane transporter activity	IDA	9950961, 10049739, 11907186, 14675047, 16024787, 22108572, 23832370, 26377792, 28534121
GO:0008514	Function	Organic anion transmembrane transporter activity	IEA
GO:0008514	Function	Organic anion transmembrane transporter activity	IMP	22169006
GO:0008514	Function	Organic anion transmembrane transporter activity	TAS
GO:0009925	Component	Basal plasma membrane	IDA	35307651
GO:0009925	Component	Basal plasma membrane	IEA
GO:0015132	Function	Prostaglandin transmembrane transporter activity	IDA	11907186
GO:0015132	Function	Prostaglandin transmembrane transporter activity	IEA
GO:0015139	Function	Alpha-ketoglutarate transmembrane transporter activity	IDA	9950961
GO:0015297	Function	Antiporter activity	IDA	9950961
GO:0015297	Function	Antiporter activity	IEA
GO:0015347	Function	Sodium-independent organic anion transmembrane transporter activity	IBA
GO:0015347	Function	Sodium-independent organic anion transmembrane transporter activity	IDA	9887087
GO:0015347	Function	Sodium-independent organic anion transmembrane transporter activity	IEA
GO:0015698	Process	Inorganic anion transport	IEA
GO:0015711	Process	Organic anion transport	IBA
GO:0015711	Process	Organic anion transport	IDA	9950961, 10049739
GO:0015711	Process	Organic anion transport	IEA
GO:0015711	Process	Organic anion transport	IEA
GO:0015711	Process	Organic anion transport	IMP	22169006
GO:0015732	Process	Prostaglandin transport	IDA	11907186
GO:0015732	Process	Prostaglandin transport	IEA
GO:0015742	Process	Alpha-ketoglutarate transport	IDA	9950961
GO:0016020	Component	Membrane	IEA
GO:0016323	Component	Basolateral plasma membrane	IDA	9887087, 15037815, 27053689
GO:0016323	Component	Basolateral plasma membrane	IEA
GO:0022857	Function	Transmembrane transporter activity	IDA	26377792
GO:0022857	Function	Transmembrane transporter activity	IEA
GO:0031404	Function	Chloride ion binding	IEA
GO:0032991	Component	Protein-containing complex	IEA
GO:0042802	Function	Identical protein binding	IEA
GO:0042908	Process	Xenobiotic transport	IEA
GO:0042910	Function	Xenobiotic transmembrane transporter activity	IDA	14675047
GO:0043252	Process	Sodium-independent organic anion transport	IDA	9887087
GO:0043252	Process	Sodium-independent organic anion transport	IEA
GO:0055085	Process	Transmembrane transport	IEA
GO:0070062	Component	Extracellular exosome	HDA	19056867
GO:0072237	Process	Metanephric proximal tubule development	IEA
GO:0097254	Process	Renal tubular secretion	IEA
GO:0097254	Process	Renal tubular secretion	IMP	22169006
GO:0097254	Process	Renal tubular secretion	NAS	9887087, 10049739

MIM	HGNC	e!Ensembl
607582	10970	ENSG00000197901

Q4U2R8

Protein name

Solute carrier family 22 member 6 (Organic anion transporter 1) (hOAT1) (PAH transporter) (hPAHT) (Renal organic anion transporter 1) (hROAT1)

Protein function

Secondary active transporter that functions as a Na(+)-independent organic anion (OA)/dicarboxylate antiporter where the uptake of one molecule of OA into the cell is coupled with an efflux of one molecule of intracellular dicarboxylate such as

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00083	Sugar_tr	101 → 518	Sugar (and other) transporter	Family

Tissue specificity

TISSUE SPECIFICITY: Strongly expressed in kidney (PubMed:10049739, PubMed:10462545, PubMed:10964714, PubMed:9887087, PubMed:9950961). Expressed at lower level in liver, skeletal muscle, brain and placenta (PubMed:10049739, PubMed:10462545, PubMed:9887087,

Sequence

MAFNDLLQQVGGVGRFQQIQVTLVVLPLLLMASHNTLQNFTAAIPTHHCRPPADANLSKN
GGLEVWLPRDRQGQPESCLRFTSPQWGLPFLNGTEANGTGATEPCTDGWIYDNSTFPSTI
VTEWDLVCSHRALRQLAQSLYMVGVLLGAMVFGYLADRLGRRKVLILNYLQTAVSGTCAA
FAPNFPIYCAFRLLSGMALAGISLNCMTLNVEWMPIHTRACVGTLIGYVYSLGQFLLAGV
AYAVPHWRHLQLLVSAPFFAFFIYSWFFIESARWHSSSGRLDLTLRALQRVARINGKREE
GAKLSMEVLRASLQKELTMGKGQASAMELLRCPTLRHLFLCLSMLWFATSFAYYGLVMDL
QGFGVSIYLIQVIFGAVDLPAKLVGFLVINSLGRRPAQMAALLLAGICILLNGVIPQDQS
IVRTSLAVLGKGCLAASFNCIFLYTGELYPTMIRQTGMGMGSTMARVGSIVSPLVSMTAE
LYPSMPLFIYGAVPVAASAVTVLLPETLGQPLPDTVQDLESRWAPTQKEAGIYPRKGKQT
RQQQEHQKYMVPLQASAQEKNGL

Sequence length

563

Interactions

View interactions

	KEGG		Reactome
	Folate transport and metabolism		Organic anion transport

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (3)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
CALCINOSIS	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
GOUT	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
INSOMNIA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (17)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Carcinoma Renal Cell	Renal cell carcinoma	Pubtator	32461965	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Chronic Kidney Diseases	Kidney Disease	BEFREE	29795395, 31525064		★★★★★ ★☆☆☆☆ Found in Text Mining only
Chronic Lymphocytic Leukemia	Lymphocytic Leukemia	BEFREE	29710508		★★★★★ ★☆☆☆☆ Found in Text Mining only
Coronary Arteriosclerosis	Coronary Arteriosclerosis	BEFREE	31125610		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetic Nephropathies	Diabetic neuropathy	Pubtator	23949796	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetic Nephropathy	Diabetic Nephropathy	BEFREE	23949796		★★★★★ ★☆☆☆☆ Found in Text Mining only
Gout	Gout	Pubtator	35406626	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hypertensive disease	Hypertension	BEFREE	21164499		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hyperuricemia	Hyperuricemia	BEFREE	28258276, 28623927, 29233733, 29379442, 29490297, 31009635		★★★★★ ★☆☆☆☆ Found in Text Mining only
Kidney Diseases	Kidney Disease	BEFREE	14984259		★★★★★ ★☆☆☆☆ Found in Text Mining only
Kidney Failure, Acute	Kidney Failure	BEFREE	26277839, 30047127, 31125610		★★★★★ ★☆☆☆☆ Found in Text Mining only
Myocardial Ischemia	Myocardial Ischemia	BEFREE	31125610		★★★★★ ★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	BEFREE	31475894		★★★★★ ★☆☆☆☆ Found in Text Mining only
Oculocerebrorenal Syndrome	Oculocerebrorenal Syndrome	BEFREE	25485598		★★★★★ ★☆☆☆☆ Found in Text Mining only
Oligospermia	Oligospermia	BEFREE	11173858		★★★★★ ★☆☆☆☆ Found in Text Mining only
Tumoral calcinosis	Tumoral Calcinosis	CTD_human_DG	12803500		★★★★★ ★☆☆☆☆ Found in Text Mining only
Vascular Diseases	Vascular disease	Pubtator	35245485	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only

SLC22A6 (solute carrier family 22 member 6)