TCEAL1 (transcription elongation factor A like 1)

Gene

• Entrez ID: 9338
• Gene name: Transcription elongation factor A like 1
• Gene symbol: TCEAL1
• Synonyms (NCBI Gene): HIJRS, NEDGFAX, SIIR, WEX9, p21, pp21
• Chromosome: X
• Chromosome location: Xq22.2
• Summary: This gene encodes a member of the transcription elongation factor A (SII)-like (TCEAL) gene family. Members of this family may function as nuclear phosphoproteins that modulate transcription in a promoter context-dependent manner. The encoded protein is s

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT005789	hsa-miR-221-3p	Western blot	21226887
MIRT005792	hsa-miR-222-3p	Western blot	21226887
MIRT005847	hsa-miR-106b-5p	Luciferase reporter assay, qRT-PCR, Western blot	21283757
MIRT005847	hsa-miR-106b-5p	Luciferase reporter assay, qRT-PCR, Western blot	21283757
MIRT005847	hsa-miR-106b-5p	Luciferase reporter assay, qRT-PCR, Western blot	21283757
MIRT005847	hsa-miR-106b-5p	Luciferase reporter assay, qRT-PCR, Western blot	21283757
MIRT006444	hsa-miR-22-3p	Immunoblot, Luciferase reporter assay, qRT-PCR	21565979
MIRT006444	hsa-miR-22-3p	Immunoblot, Luciferase reporter assay, qRT-PCR	21565979
MIRT006444	hsa-miR-22-3p	Immunoblot, Luciferase reporter assay, qRT-PCR	21565979
MIRT006444	hsa-miR-22-3p	Immunoblot, Luciferase reporter assay, qRT-PCR	21565979
MIRT006444	hsa-miR-22-3p	Immunoblot, Luciferase reporter assay, qRT-PCR	21565979
MIRT006444	hsa-miR-22-3p	Immunoblot, Luciferase reporter assay, qRT-PCR	21565979
MIRT006444	hsa-miR-22-3p	Immunoblot, Luciferase reporter assay, qRT-PCR	21565979
MIRT006444	hsa-miR-22-3p	Immunoblot, Luciferase reporter assay, qRT-PCR	21565979
MIRT006444	hsa-miR-22-3p	Immunoblot, Luciferase reporter assay, qRT-PCR	21565979
MIRT005847	hsa-miR-106b-5p	Luciferase reporter assay	22613985
MIRT006732	hsa-miR-663a	Luciferase reporter assay	22249270
MIRT006732	hsa-miR-663a	Luciferase reporter assay	22249270
MIRT006732	hsa-miR-663a	Luciferase reporter assay	22249270
MIRT016156	hsa-miR-605-5p	qRT-PCR	21217645
MIRT016255	hsa-miR-504-5p	Western blot;qRT-PCR	20542001
MIRT005847	hsa-miR-106b-5p	Microarray	17242205
MIRT029229	hsa-miR-26b-5p	Microarray	19088304
MIRT053204	hsa-miR-224-5p	Flow, Luciferase reporter assay, Microarray, qRT-PCR, Western blot	23399735
MIRT005847	hsa-miR-106b-5p	Flow, Luciferase reporter assay, qRT-PCR, Western blot	23028803
MIRT054219	hsa-miR-25-3p	Flow, Luciferase reporter assay, qRT-PCR, Western blot	23028803
0	hsa-miR-345-5p	Immunoprecipitation, Luciferase reporter assay, qRT-PCR, Western blot	23577194
MIRT031362	hsa-miR-17-5p	qRT-PCR	24901013
MIRT031362	hsa-miR-17-5p	Luciferase reporter assay, qRT-PCR, Western blot	23716467
MIRT031362	hsa-miR-17-5p	Luciferase reporter assay, qRT-PCR, Western blot	23716467
MIRT031362	hsa-miR-17-5p	Luciferase reporter assay, qRT-PCR, Western blot	23716467
MIRT438926	hsa-miR-370-3p	ChIP-seq, Flow, Immunofluorescence, qRT-PCR, Western blot	25447520
MIRT438925	hsa-miR-1180-3p	ChIP-seq, Flow, Immunofluorescence, qRT-PCR, Western blot	25447520
MIRT438924	hsa-miR-1236-3p	ChIP-seq, Flow, Immunofluorescence, qRT-PCR, Western blot	25447520
MIRT031362	hsa-miR-17-5p	Luciferase reporter assay, Microarray, Northern blot, qRT-PCR, Western blot	23059786
MIRT000178	hsa-miR-20a-5p	Luciferase reporter assay, Microarray, Northern blot, qRT-PCR, Western blot	23059786
MIRT438926	hsa-miR-370-3p	ChIP-seq, Flow, Immunofluorescence, qRT-PCR, Western blot	25447520
MIRT438925	hsa-miR-1180-3p	ChIP-seq, Flow, Immunofluorescence, qRT-PCR, Western blot	25447520
MIRT438924	hsa-miR-1236-3p	ChIP-seq, Flow, Immunofluorescence, qRT-PCR, Western blot	25447520
MIRT031362	hsa-miR-17-5p	Luciferase reporter assay, Microarray, Northern blot, qRT-PCR, Western blot	23059786
MIRT000178	hsa-miR-20a-5p	Luciferase reporter assay, Microarray, Northern blot, qRT-PCR, Western blot	23059786
MIRT053204	hsa-miR-224-5p	Flow, Luciferase reporter assay, qRT-PCR, Western blot	26343737
MIRT053204	hsa-miR-224-5p	Flow, Luciferase reporter assay, qRT-PCR, Western blot	26343737
MIRT031362	hsa-miR-17-5p	Luciferase reporter assay, Western blot	28280038
MIRT1415558	hsa-miR-2355-3p	CLIP-seq
MIRT1415559	hsa-miR-2909	CLIP-seq
MIRT1415560	hsa-miR-3140-5p	CLIP-seq
MIRT1415561	hsa-miR-3660	CLIP-seq
MIRT1415562	hsa-miR-3662	CLIP-seq
MIRT1415563	hsa-miR-3674	CLIP-seq
MIRT1415564	hsa-miR-3935	CLIP-seq
MIRT1415565	hsa-miR-3942-3p	CLIP-seq
MIRT1415566	hsa-miR-4256	CLIP-seq
MIRT1415567	hsa-miR-4278	CLIP-seq
MIRT1415568	hsa-miR-4477a	CLIP-seq
MIRT1415569	hsa-miR-4503	CLIP-seq
MIRT1415570	hsa-miR-4526	CLIP-seq
MIRT1415571	hsa-miR-4646-3p	CLIP-seq
MIRT1415572	hsa-miR-4666-5p	CLIP-seq
MIRT1415573	hsa-miR-4716-3p	CLIP-seq
MIRT1415574	hsa-miR-4766-5p	CLIP-seq
MIRT1415575	hsa-miR-539	CLIP-seq
MIRT1415576	hsa-miR-561	CLIP-seq
MIRT1415577	hsa-miR-577	CLIP-seq
MIRT1415578	hsa-miR-583	CLIP-seq
MIRT1415579	hsa-miR-625	CLIP-seq
MIRT1415580	hsa-miR-676	CLIP-seq
MIRT1415559	hsa-miR-2909	CLIP-seq
MIRT1415561	hsa-miR-3660	CLIP-seq
MIRT1415563	hsa-miR-3674	CLIP-seq
MIRT1415564	hsa-miR-3935	CLIP-seq
MIRT1415566	hsa-miR-4256	CLIP-seq
MIRT1415567	hsa-miR-4278	CLIP-seq
MIRT1415568	hsa-miR-4477a	CLIP-seq
MIRT1415569	hsa-miR-4503	CLIP-seq
MIRT1415570	hsa-miR-4526	CLIP-seq
MIRT1415573	hsa-miR-4716-3p	CLIP-seq
MIRT1415576	hsa-miR-561	CLIP-seq
MIRT1415578	hsa-miR-583	CLIP-seq
MIRT1415579	hsa-miR-625	CLIP-seq
MIRT2639721	hsa-miR-129-5p	CLIP-seq
MIRT2639722	hsa-miR-147	CLIP-seq
MIRT1415558	hsa-miR-2355-3p	CLIP-seq
MIRT1415559	hsa-miR-2909	CLIP-seq
MIRT1415560	hsa-miR-3140-5p	CLIP-seq
MIRT2639723	hsa-miR-3153	CLIP-seq
MIRT2639724	hsa-miR-3653	CLIP-seq
MIRT2639725	hsa-miR-3658	CLIP-seq
MIRT1415562	hsa-miR-3662	CLIP-seq
MIRT1415563	hsa-miR-3674	CLIP-seq
MIRT2639726	hsa-miR-3910	CLIP-seq
MIRT1415564	hsa-miR-3935	CLIP-seq
MIRT1415565	hsa-miR-3942-3p	CLIP-seq
MIRT1415567	hsa-miR-4278	CLIP-seq
MIRT2639727	hsa-miR-4282	CLIP-seq
MIRT2639728	hsa-miR-4328	CLIP-seq
MIRT1415569	hsa-miR-4503	CLIP-seq
MIRT2639729	hsa-miR-450b-5p	CLIP-seq
MIRT2639730	hsa-miR-4528	CLIP-seq
MIRT2639731	hsa-miR-4645-3p	CLIP-seq
MIRT1415571	hsa-miR-4646-3p	CLIP-seq
MIRT2639732	hsa-miR-4659a-3p	CLIP-seq
MIRT2639733	hsa-miR-4659b-3p	CLIP-seq
MIRT1415572	hsa-miR-4666-5p	CLIP-seq
MIRT2639734	hsa-miR-4668-5p	CLIP-seq
MIRT2639735	hsa-miR-4698	CLIP-seq
MIRT1415573	hsa-miR-4716-3p	CLIP-seq
MIRT2639736	hsa-miR-4719	CLIP-seq
MIRT2639737	hsa-miR-4731-3p	CLIP-seq
MIRT2639738	hsa-miR-4801	CLIP-seq
MIRT2639739	hsa-miR-507	CLIP-seq
MIRT1415575	hsa-miR-539	CLIP-seq
MIRT2639740	hsa-miR-548ad	CLIP-seq
MIRT2639741	hsa-miR-548an	CLIP-seq
MIRT2639742	hsa-miR-557	CLIP-seq
MIRT1415577	hsa-miR-577	CLIP-seq
MIRT1415578	hsa-miR-583	CLIP-seq
MIRT1415579	hsa-miR-625	CLIP-seq
MIRT1415580	hsa-miR-676	CLIP-seq
MIRT2639721	hsa-miR-129-5p	CLIP-seq
MIRT2639722	hsa-miR-147	CLIP-seq
MIRT1415558	hsa-miR-2355-3p	CLIP-seq
MIRT1415559	hsa-miR-2909	CLIP-seq
MIRT1415560	hsa-miR-3140-5p	CLIP-seq
MIRT2639723	hsa-miR-3153	CLIP-seq
MIRT2639724	hsa-miR-3653	CLIP-seq
MIRT2639725	hsa-miR-3658	CLIP-seq
MIRT1415562	hsa-miR-3662	CLIP-seq
MIRT1415563	hsa-miR-3674	CLIP-seq
MIRT2639726	hsa-miR-3910	CLIP-seq
MIRT1415564	hsa-miR-3935	CLIP-seq
MIRT1415565	hsa-miR-3942-3p	CLIP-seq
MIRT1415567	hsa-miR-4278	CLIP-seq
MIRT2639727	hsa-miR-4282	CLIP-seq
MIRT2639728	hsa-miR-4328	CLIP-seq
MIRT1415569	hsa-miR-4503	CLIP-seq
MIRT2639729	hsa-miR-450b-5p	CLIP-seq
MIRT2639730	hsa-miR-4528	CLIP-seq
MIRT2639731	hsa-miR-4645-3p	CLIP-seq
MIRT1415571	hsa-miR-4646-3p	CLIP-seq
MIRT2639732	hsa-miR-4659a-3p	CLIP-seq
MIRT2639733	hsa-miR-4659b-3p	CLIP-seq
MIRT1415572	hsa-miR-4666-5p	CLIP-seq
MIRT2639734	hsa-miR-4668-5p	CLIP-seq
MIRT2639735	hsa-miR-4698	CLIP-seq
MIRT1415573	hsa-miR-4716-3p	CLIP-seq
MIRT2639736	hsa-miR-4719	CLIP-seq
MIRT2639737	hsa-miR-4731-3p	CLIP-seq
MIRT2639738	hsa-miR-4801	CLIP-seq
MIRT2639739	hsa-miR-507	CLIP-seq
MIRT1415575	hsa-miR-539	CLIP-seq
MIRT2639740	hsa-miR-548ad	CLIP-seq
MIRT2639741	hsa-miR-548an	CLIP-seq
MIRT2639742	hsa-miR-557	CLIP-seq
MIRT1415577	hsa-miR-577	CLIP-seq
MIRT1415578	hsa-miR-583	CLIP-seq
MIRT1415579	hsa-miR-625	CLIP-seq
MIRT1415580	hsa-miR-676	CLIP-seq

Transcription factors

Transcription factor	Regulation	Reference
TP53	Unknown	20421190

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005515	Function	Protein binding	IPI	32296183
GO:0005634	Component	Nucleus	IDA	7971997
GO:0005634	Component	Nucleus	IEA
GO:0005654	Component	Nucleoplasm	IDA
GO:0010629	Process	Negative regulation of gene expression	TAS	7971997

Other IDs

• MIM: 300237
• HGNC: 11616
• e!Ensembl: ENSG00000172465

Protein

• UniProt ID: Q15170
• Protein name: Transcription elongation factor A protein-like 1 (TCEA-like protein 1) (Nuclear phosphoprotein p21/SIIR) (Transcription elongation factor S-II protein-like 1)
• Protein function: May be involved in transcriptional regulation. Modulates various viral and cellular promoters in a promoter context-dependent manner. For example, transcription from the FOS promoter is increased, while Rous sarcoma virus (RSV) long terminal rep
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF04538	BEX	1 → 157	Brain expressed X-linked like family	Family

• Tissue specificity: TISSUE SPECIFICITY: Expressed in all tissues examined. Highly expressed in heart, ovary, prostate and skeletal muscle. Moderately expressed in brain, placenta, testis and small intestine. Weakly expressed in lung, liver and spleen. Expressed in several ca
• Sequence:

  MDKPRKENEEEPQSRPRPMRRGLRWSTLPKSSPPRSSLRRSSPRRRSSFLRSSCLSSCLR
  CSSRRTPSAGLSRKDLFEGRPPMEQPPCGVGKHKLEEGSFKERLARSRPQFRGDIHGRNL
  SNEEMIQAADELEEMKRVRNKLMIMHWKAKRSRPYPI

• Sequence length: 157

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Causal
Phenotype Name	Clinical Significance	dbSNP ID	RCV Accession	Evidence Score
Neurodevelopmental disorder with gait disturbance, dysmorphic facies, and behavioral abnormalities, X-linked	Likely pathogenic	rs2147642131, rs2147641982, rs2147641920, rs2147641927, rs2147641837, rs2521930122, rs1187653939, rs2521931086, rs2521931041	RCV003152641 RCV003152642 RCV003152643 RCV003152644 RCV003152645 RCV003459047 RCV003459048 RCV003459049 RCV003459050	★★★★★ ClinVar: Pathogenic / Likely Pathogenic (≥5 Variants)

Associations from Text Mining
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Autistic Disorder	Autism	Pubtator	36368327	Associate	★☆☆☆☆ Found in Text Mining only
Brain Diseases	Brain disease	Pubtator	36368327	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	34245919	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma of lung	Lung carcinoma	BEFREE	18046503		★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	28445988		★☆☆☆☆ Found in Text Mining only
Constipation	Constipation	Pubtator	36368327	Associate	★☆☆☆☆ Found in Text Mining only
Conventional (Clear Cell) Renal Cell Carcinoma	Renal Carcinoma	BEFREE	19384944		★☆☆☆☆ Found in Text Mining only
Developmental Disabilities	Developmental disability	Pubtator	36368327	Associate	★☆☆☆☆ Found in Text Mining only
Gastroesophageal Reflux	Gastroesophageal reflux disease	Pubtator	36368327	Associate	★☆☆☆☆ Found in Text Mining only
Intellectual Disability	Intellectual developmental disorder	Pubtator	36368327	Associate	★☆☆☆☆ Found in Text Mining only
Keratocystic Odontogenic Tumor	Keratocystic Odontogenic Tumor	BEFREE	19192054		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of esophagus	Esophagus Neoplasm	BEFREE	15773840		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of lung	Lung Cancer	BEFREE	18046503		★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	11820590, 15198903, 28994324		★☆☆☆☆ Found in Text Mining only
Nervous System Diseases	Nervous system disease	Pubtator	36368327	Associate	★☆☆☆☆ Found in Text Mining only
Nystagmus Pathologic	Nystagmus	Pubtator	36368327	Associate	★☆☆☆☆ Found in Text Mining only
Osteosarcoma	Osteosarcoma	BEFREE	15198903		★☆☆☆☆ Found in Text Mining only
Renal Cell Carcinoma	Renal Carcinoma	BEFREE	19384944		★☆☆☆☆ Found in Text Mining only
Schizophrenia	Schizophrenia	BEFREE	28450949		★☆☆☆☆ Found in Text Mining only
Seizures	Seizures	Pubtator	36368327	Associate	★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma	Carcinoma	BEFREE	18251939		★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of esophagus	Esophagus Neoplasm	BEFREE	26932598		★☆☆☆☆ Found in Text Mining only
Squamous Cell Neoplasms	Neoplasm	LHGDN	15773840		★☆☆☆☆ Found in Text Mining only
Strabismus	Strabismus	Pubtator	36368327	Associate	★☆☆☆☆ Found in Text Mining only
Ulcerative Colitis	Ulcerative colitis	BEFREE	11820590, 29869393		★☆☆☆☆ Found in Text Mining only