Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Associated diseases
Entrez ID	93377
Gene name	Oligodendrocytic myelin paranodal and inner loop protein
Gene symbol	OPALIN
Synonyms (NCBI Gene)	HTMP10TMEM10TMP10
Chromosome	10
Chromosome location	10q24.1

Show/Hide all (78)

miRTarBase ID	miRNA	Experiments	Reference
MIRT645823	hsa-miR-6769a-3p	HITS-CLIP	23824327
MIRT645822	hsa-miR-186-3p	HITS-CLIP	23824327
MIRT645823	hsa-miR-6769a-3p	HITS-CLIP	23824327
MIRT645822	hsa-miR-186-3p	HITS-CLIP	23824327
MIRT1204057	hsa-miR-1224-5p	CLIP-seq
MIRT1204058	hsa-miR-1245	CLIP-seq
MIRT1204059	hsa-miR-1252	CLIP-seq
MIRT1204060	hsa-miR-1304	CLIP-seq
MIRT1204061	hsa-miR-1913	CLIP-seq
MIRT1204062	hsa-miR-202	CLIP-seq
MIRT1204063	hsa-miR-3154	CLIP-seq
MIRT1204064	hsa-miR-324-3p	CLIP-seq
MIRT1204065	hsa-miR-346	CLIP-seq
MIRT1204066	hsa-miR-3915	CLIP-seq
MIRT1204067	hsa-miR-3928	CLIP-seq
MIRT1204068	hsa-miR-4257	CLIP-seq
MIRT1204069	hsa-miR-4689	CLIP-seq
MIRT1204070	hsa-miR-4769-3p	CLIP-seq
MIRT1204071	hsa-miR-640	CLIP-seq
MIRT1204072	hsa-let-7a	CLIP-seq
MIRT1204073	hsa-let-7b	CLIP-seq
MIRT1204074	hsa-let-7c	CLIP-seq
MIRT1204075	hsa-let-7d	CLIP-seq
MIRT1204076	hsa-let-7e	CLIP-seq
MIRT1204077	hsa-let-7f	CLIP-seq
MIRT1204078	hsa-let-7g	CLIP-seq
MIRT1204079	hsa-let-7i	CLIP-seq
MIRT1204080	hsa-miR-147	CLIP-seq
MIRT1204081	hsa-miR-3185	CLIP-seq
MIRT1204082	hsa-miR-3529	CLIP-seq
MIRT1204083	hsa-miR-361-5p	CLIP-seq
MIRT1204084	hsa-miR-3650	CLIP-seq
MIRT1204085	hsa-miR-379	CLIP-seq
MIRT1204086	hsa-miR-3911	CLIP-seq
MIRT1204087	hsa-miR-3934	CLIP-seq
MIRT1204088	hsa-miR-3942-5p	CLIP-seq
MIRT1204089	hsa-miR-4269	CLIP-seq
MIRT1204090	hsa-miR-4451	CLIP-seq
MIRT1204091	hsa-miR-4458	CLIP-seq
MIRT1204092	hsa-miR-4476	CLIP-seq
MIRT1204093	hsa-miR-4500	CLIP-seq
MIRT1204094	hsa-miR-4514	CLIP-seq
MIRT1204095	hsa-miR-4536	CLIP-seq
MIRT1204096	hsa-miR-4650-3p	CLIP-seq
MIRT1204097	hsa-miR-4692	CLIP-seq
MIRT1204098	hsa-miR-4703-5p	CLIP-seq
MIRT1204099	hsa-miR-4717-5p	CLIP-seq
MIRT1204100	hsa-miR-4742-5p	CLIP-seq
MIRT1204101	hsa-miR-4747-5p	CLIP-seq
MIRT1204102	hsa-miR-644	CLIP-seq
MIRT1204103	hsa-miR-98	CLIP-seq
MIRT1204072	hsa-let-7a	CLIP-seq
MIRT1204073	hsa-let-7b	CLIP-seq
MIRT1204074	hsa-let-7c	CLIP-seq
MIRT1204075	hsa-let-7d	CLIP-seq
MIRT1204076	hsa-let-7e	CLIP-seq
MIRT1204077	hsa-let-7f	CLIP-seq
MIRT1204078	hsa-let-7g	CLIP-seq
MIRT1204079	hsa-let-7i	CLIP-seq
MIRT1204081	hsa-miR-3185	CLIP-seq
MIRT1204091	hsa-miR-4458	CLIP-seq
MIRT1204092	hsa-miR-4476	CLIP-seq
MIRT1204093	hsa-miR-4500	CLIP-seq
MIRT1204101	hsa-miR-4747-5p	CLIP-seq
MIRT1204103	hsa-miR-98	CLIP-seq
MIRT2058952	hsa-miR-4263	CLIP-seq
MIRT2287042	hsa-miR-3920	CLIP-seq
MIRT2287043	hsa-miR-4731-3p	CLIP-seq
MIRT2287044	hsa-miR-4801	CLIP-seq
MIRT2455637	hsa-miR-1238	CLIP-seq
MIRT2455638	hsa-miR-3183	CLIP-seq
MIRT2455639	hsa-miR-3691-3p	CLIP-seq
MIRT2455640	hsa-miR-4292	CLIP-seq
MIRT2455641	hsa-miR-4723-3p	CLIP-seq
MIRT2455642	hsa-miR-4727-5p	CLIP-seq
MIRT1204070	hsa-miR-4769-3p	CLIP-seq
MIRT2455643	hsa-miR-515-5p	CLIP-seq
MIRT2455644	hsa-miR-544	CLIP-seq

Show/Hide all (9)

GO ID	Ontology	Definition	Evidence
GO:0005794	Component	Golgi apparatus	IDA
GO:0005886	Component	Plasma membrane	IBA
GO:0005886	Component	Plasma membrane	IEA
GO:0005886	Component	Plasma membrane	ISS
GO:0016020	Component	Membrane	IEA
GO:0044291	Component	Cell-cell contact zone	IBA
GO:0044291	Component	Cell-cell contact zone	IEA
GO:0048713	Process	Regulation of oligodendrocyte differentiation	IEA
GO:0048713	Process	Regulation of oligodendrocyte differentiation	ISS

MIM	HGNC	e!Ensembl
617200	20707	ENSG00000197430

Q96PE5

Protein name

Opalin (Oligodendrocytic myelin paranodal and inner loop protein) (Transmembrane protein 10)

Protein function

Central nervous system-specific myelin protein that increase myelin genes expression during oligodendrocyte differentiation. Promotes oligodendrocyte terminal differentiation.

Family and domains

Tissue specificity

TISSUE SPECIFICITY: Brain specific; expressed in oligodendrocytes (PubMed:11814680, PubMed:30837646). Expressed in oligodendrocytes in remyelinating multiple sclerosis plaques (PubMed:30837646). {ECO:0000269|PubMed:11814680, ECO:0000269|PubMed:30837646}.

Sequence

MSFSLNFTLPANTTSSPVTGGKETDCGPSLGLAAGIPLLVATALLVALLFTLIHRRRSSI
EAMEESDRPCEISEIDDNPKISENPRRSPTHEKNTMGAQEAHIYVKTVAGSEEPVHDRYR
PTIEMERRRGLWWLVPRLSLE

Sequence length

141

Interactions

View interactions

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (1)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
DEMENTIA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (5)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Demyelinating Diseases	Demyelinating Diseases	BEFREE	30837646		★★★★★ ★☆☆☆☆ Found in Text Mining only
Focal Cortical Dysplasia	Focal cortical dysplasia	Pubtator	34301297	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Focal cortical dysplasia of Taylor	Focal cortical dysplasia	Pubtator	34301297	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	Pubtator	34516348	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	35358005	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only

OPALIN (oligodendrocytic myelin paranodal and inner loop protein)