Gene Gene information from NCBI Gene database.
Entrez ID 9331
Gene name Beta-1,4-galactosyltransferase 6
Gene symbol B4GALT6
Synonyms (NCBI Gene)
B4Gal-T6beta4Gal-T6
Chromosome 18
Chromosome location 18q12.1
Summary This gene is one of seven beta-1,4-galactosyltransferase (beta4GalT) genes in human. They encode type II membrane-bound glycoproteins that appear to have exclusive specificity for the donor substrate UDP-galactose; all transfer galactose in a beta1,4 link
miRNA miRNA information provided by mirtarbase database.
126
miRTarBase ID miRNA Experiments Reference
MIRT018554 hsa-miR-335-5p Microarray 18185580
MIRT024717 hsa-miR-215-5p Microarray 19074876
MIRT026806 hsa-miR-192-5p Microarray 19074876
MIRT708193 hsa-miR-8485 HITS-CLIP 21572407
MIRT708192 hsa-miR-329-3p HITS-CLIP 21572407
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
33
GO ID Ontology Definition Evidence Reference
GO:0000139 Component Golgi membrane IEA
GO:0000139 Component Golgi membrane TAS
GO:0001572 Process Lactosylceramide biosynthetic process IDA 10320813
GO:0005515 Function Protein binding IPI 33961781
GO:0005794 Component Golgi apparatus IBA
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
MIM HGNC e!Ensembl
604017 929 ENSG00000118276
Protein Protein information from UniProt database.
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q9UBX8
Protein name Beta-1,4-galactosyltransferase 6 (Beta-1,4-GalTase 6) (Beta4Gal-T6) (b4Gal-T6) (EC 2.4.1.-) (Glucosylceramide beta-1,4-galactosyltransferase) (EC 2.4.1.274) (Lactosylceramide synthase) (LacCer synthase) (UDP-Gal:beta-GlcNAc beta-1,4-galactosyltransferase
Protein function Catalyzes the synthesis of lactosylceramide (LacCer) via the transfer of galactose from UDP-galactose to glucosylceramide (GlcCer) (PubMed:1551920, PubMed:24498430, PubMed:3099851). LacCer is the starting point in the biosynthesis of all ganglio
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF13733 Glyco_transf_7N 108 243 N-terminal region of glycosyl transferase group 7 Domain
PF02709 Glyco_transf_7C 247 325 N-terminal domain of galactosyltransferase Family
Tissue specificity TISSUE SPECIFICITY: High expression in brain and adrenal gland, lower in liver, lung, colon and peripheral white blood cells.
Sequence
MSVLRRMMRVSNRSLLAFIFFFSLSSSCLYFIYVAPGIANTYLFMVQARGIMLRENVKTI
GHMIRLYTNKNSTLNGTDYPEGNNSSDYLVQTTTYLPENFTYSPYLPCPEKLPYMRGFLN
VNVSEVSFDEIHQLFSKDLDIEPGGHWRPKDCKPRWKVAVLIPFRNRHEHLPIFFLHLIP
MLQKQRLEFAFYVIEQTGTQPFNRAMLFNVGFKEAMKDSVWDCVIFHDVDHLPENDRNYY
GCG
EMPRHFAAKLDKYMYILPYKEFFGGVSGLTVEQFRKINGFPNAFWGWGGEDDDLWNR
VHYAGYNVTRPEGDLGKYKSIPHHH
RGEVQFLGRYKLLRYSKERQYIDGLNNLIYRPKIL
VDRLYTNISVNLMPELAPIEDY
Sequence length 382
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  KEGG  Reactome
  Sphingolipid metabolism
Metabolic pathways
  Keratan sulfate biosynthesis
O-linked glycosylation of mucins
N-Glycan antennae elongation
Associated diseases Disease associations from ClinVar (causal & non-causal) and other databases (OMIM, Orphanet, GWAS, etc.).
1
Evidence Score: ★☆☆☆☆  Gene-disease association found in Text Mining only ★★☆☆☆  Found in Text Mining and Unknown/Other Associations ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
Phenotype Name Clinical Significance Source Evidence Score
AMYOTROPHIC LATERAL SCLEROSIS GWAS catalog
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
Associations from Text Mining Disease associations identified through text mining
Disease Name Disease (Merged) Source PMID Relationship Type Evidence Score
Colorectal Carcinoma Colorectal Cancer BEFREE 30502090
★☆☆☆☆
Found in Text Mining only
Developmental Disabilities Developmental disability Pubtator 24668659 Associate
★☆☆☆☆
Found in Text Mining only
Multiple Sclerosis Multiple Sclerosis BEFREE 25216636
★☆☆☆☆
Found in Text Mining only
Schizophrenia Schizophrenia Pubtator 18683247 Inhibit
★☆☆☆☆
Found in Text Mining only
Skin Abnormalities Skin abnormalities Pubtator 24668659 Associate
★☆☆☆☆
Found in Text Mining only