NREP (neuronal regeneration related protein)

Gene

• Entrez ID: 9315
• Gene name: Neuronal regeneration related protein
• Gene symbol: NREP
• Synonyms (NCBI Gene): C5orf13, D4S114, P311, PRO1873, PTZ17, SEZ17
• Chromosome: 5
• Chromosome location: 5q22.1

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT024413	hsa-miR-215-5p	Microarray	19074876
MIRT026664	hsa-miR-192-5p	Microarray	19074876
MIRT027728	hsa-miR-98-5p	Microarray	19088304
MIRT048382	hsa-miR-29b-3p	CLASH	23622248
MIRT561843	hsa-miR-7-5p	PAR-CLIP	20371350
MIRT561842	hsa-miR-3617-5p	PAR-CLIP	20371350
MIRT561841	hsa-miR-641	PAR-CLIP	20371350
MIRT561840	hsa-miR-219a-1-3p	PAR-CLIP	20371350
MIRT561839	hsa-miR-571	PAR-CLIP	20371350
MIRT561838	hsa-miR-6077	PAR-CLIP	20371350
MIRT561837	hsa-miR-3190-3p	PAR-CLIP	20371350
MIRT561836	hsa-miR-3613-5p	PAR-CLIP	20371350
MIRT561835	hsa-miR-6833-5p	PAR-CLIP	20371350
MIRT561834	hsa-miR-4752	PAR-CLIP	20371350
MIRT561843	hsa-miR-7-5p	PAR-CLIP	20371350
MIRT561842	hsa-miR-3617-5p	PAR-CLIP	20371350
MIRT561841	hsa-miR-641	PAR-CLIP	20371350
MIRT561840	hsa-miR-219a-1-3p	PAR-CLIP	20371350
MIRT561839	hsa-miR-571	PAR-CLIP	20371350
MIRT561838	hsa-miR-6077	PAR-CLIP	20371350
MIRT561837	hsa-miR-3190-3p	PAR-CLIP	20371350
MIRT561836	hsa-miR-3613-5p	PAR-CLIP	20371350
MIRT561835	hsa-miR-6833-5p	PAR-CLIP	20371350
MIRT561834	hsa-miR-4752	PAR-CLIP	20371350

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005515	Function	Protein binding	IPI	22365962
GO:0005737	Component	Cytoplasm	IEA
GO:0017015	Process	Regulation of transforming growth factor beta receptor signaling pathway	IBA
GO:0017015	Process	Regulation of transforming growth factor beta receptor signaling pathway	IEA
GO:0031103	Process	Axon regeneration	IBA
GO:0031103	Process	Axon regeneration	IEA
GO:0045664	Process	Regulation of neuron differentiation	IBA
GO:0045664	Process	Regulation of neuron differentiation	IEA

Other IDs

• MIM: 607332
• HGNC: 16834
• e!Ensembl: ENSG00000134986

Protein

• UniProt ID: Q16612
• Protein name: Neuronal regeneration-related protein (Neuronal protein 3.1) (Protein p311)
• Protein function: May have roles in neural function. Ectopic expression augments motility of gliomas. Also promotes axonal regeneration (By similarity). May also have functions in cellular differentiation (By similarity). Induces differentiation of fibroblast int
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF11092	Alveol-reg_P311	2 → 68	Neuronal protein 3.1 (p311)	Family

• Tissue specificity: TISSUE SPECIFICITY: Expressed in lung (at protein level). {ECO:0000269|PubMed:16484684}.
• Sequence:

  MVYYPELFVWVSQEPFPNKDMEGRLPKGRLPVPKEVNRKKNDETNAASLTPLGSSELRSP
  RISYLHFF

• Sequence length: 68

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
ANDROGENETIC ALOPECIA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ASTHMA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ASTROCYTOMA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ATTENTION DEFICIT HYPERACTIVITY DISORDER	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
AUTISM SPECTRUM DISORDER	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BIPOLAR DISORDER	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BREAST CANCER	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BREAST CARCINOMA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DIVERTICULAR DISEASE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
FATTY LIVER	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
FATTY LIVER, ALCOHOLIC	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
INSOMNIA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LIVER CIRRHOSIS, EXPERIMENTAL	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MENTAL OR BEHAVIOURAL DISORDER	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
METABOLIC SYNDROME	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SCHIZOPHRENIA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SCOLIOSIS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TYPE 2 DIABETES MELLITUS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Bloom Syndrome	Bloom Syndrome	BEFREE	30230348		★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	GWASCAT_DG	29059683		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Congenital heart disease	Congenital Heart Disease	BEFREE	29952356		★☆☆☆☆ Found in Text Mining only
Coronary heart disease	Coronary Heart Disease	BEFREE	26014430		★☆☆☆☆ Found in Text Mining only
Depressive Disorder	Major depressive disorder	Pubtator	34972135	Associate	★☆☆☆☆ Found in Text Mining only
Fatty Liver	Fatty Liver	CTD_human_DG	25226513		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Fatty Liver	Fatty liver	Pubtator	37354909	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Glioblastoma	Glioblastoma	BEFREE	11358844		★☆☆☆☆ Found in Text Mining only
Glioblastoma Multiforme	Glioblastoma	BEFREE	11358844		★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	BEFREE	16229809		★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	Pubtator	16229809	Associate	★☆☆☆☆ Found in Text Mining only
Glomerulonephritis IGA	Iga nephropathy	Pubtator	19946746	Associate	★☆☆☆☆ Found in Text Mining only
Heart Septal Defects	Heart Septal Defects	BEFREE	29952356		★☆☆☆☆ Found in Text Mining only
Huntington Disease	Huntington Disease	BEFREE	2905444		★☆☆☆☆ Found in Text Mining only
Hypertensive disease	Hypertension	BEFREE	24091331		★☆☆☆☆ Found in Text Mining only
Idiopathic Pulmonary Fibrosis	Pulmonary Fibrosis	BEFREE	30230348		★☆☆☆☆ Found in Text Mining only
Leukemia Myeloid Acute	Myeloid leukemia	Pubtator	37798266	Associate	★☆☆☆☆ Found in Text Mining only
Metabolic Syndrome	Metabolic syndrome	Pubtator	37354909	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Migraine Disorders	Migraine	Pubtator	34972135	Associate	★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	11358844		★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	Pubtator	11501497	Associate	★☆☆☆☆ Found in Text Mining only
Proteinuria	Proteinuria	Pubtator	19946746	Associate	★☆☆☆☆ Found in Text Mining only
Pulmonary Emphysema	Pulmonary Emphysema	BEFREE	16484684		★☆☆☆☆ Found in Text Mining only
Pulmonary Fibrosis	Pulmonary Fibrosis	BEFREE	30230348		★☆☆☆☆ Found in Text Mining only
Renal fibrosis	Renal fibrosis	BEFREE	26559022, 26616407, 29311449, 29436600		★☆☆☆☆ Found in Text Mining only
Steatohepatitis	Fatty Liver	CTD_human_DG	25226513		★☆☆☆☆ Found in Text Mining only
Thyroid Neoplasms	Thyroid cancer	Pubtator	28195142	Associate	★☆☆☆☆ Found in Text Mining only