Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	9314
Gene name	KLF transcription factor 4
Gene symbol	KLF4
Synonyms (NCBI Gene)	EZFGKLF
Chromosome	9
Chromosome location	9q31.2
Summary	This gene encodes a protein that belongs to the Kruppel family of transcription factors. The encoded zinc finger protein is required for normal development of the barrier function of skin. The encoded protein is thought to control the G1-to-S transition o

390

Show/Hide all (390)

miRTarBase ID	miRNA	Experiments	Reference
MIRT003605	hsa-miR-25-3p	Western blot	19541842
MIRT003216	hsa-miR-10b-5p	Luciferase reporter assayWestern blot	20075075
MIRT003216	hsa-miR-10b-5p	Luciferase reporter assayWestern blot	20075075
MIRT005674	hsa-miR-130a-3p	Luciferase reporter assayMicroarrayqRT-PCR	20981674
MIRT005440	hsa-miR-135b-5p	Luciferase reporter assayMicroarrayqRT-PCR	20981674
MIRT000308	hsa-miR-145-5p	FACSFlowGFP reporter assayIn situ hybridizationLuciferase reporter assayqRT-PCR	19409607
MIRT000308	hsa-miR-145-5p	FACSFlowGFP reporter assayIn situ hybridizationLuciferase reporter assayqRT-PCR	19409607
MIRT006086	hsa-miR-663a	MicroarrayqRT-PCR	21378144
MIRT006086	hsa-miR-663a	MicroarrayqRT-PCR	21378144
MIRT006086	hsa-miR-663a	MicroarrayqRT-PCR	21378144
MIRT006688	hsa-miR-103a-3p	Luciferase reporter assayWestern blot	22593189
MIRT006688	hsa-miR-103a-3p	Luciferase reporter assayWestern blot	22593189
MIRT006688	hsa-miR-103a-3p	Luciferase reporter assayWestern blot	22593189
MIRT006688	hsa-miR-103a-3p	Luciferase reporter assayWestern blot	22593189
MIRT006692	hsa-miR-107	Luciferase reporter assayWestern blot	22593189
MIRT006692	hsa-miR-107	Luciferase reporter assayWestern blot	22593189
MIRT006692	hsa-miR-107	Luciferase reporter assayWestern blot	22593189
MIRT006692	hsa-miR-107	Luciferase reporter assayWestern blot	22593189
MIRT016880	hsa-miR-335-5p	Microarray	18185580
MIRT000308	hsa-miR-145-5p	Reporter assay;Western blot;qRT-PCR	19409607
MIRT021926	hsa-miR-128-3p	Reporter assay	19409607
MIRT022234	hsa-miR-124-3p	Microarray	18668037
MIRT046110	hsa-miR-30b-5p	CLASH	23622248
MIRT052916	hsa-miR-29a-3p	ImmunoprecipitaionLuciferase reporter assayqRT-PCRWestern blot	24281002
MIRT053079	hsa-miR-15a-5p	Western blot	23867820
MIRT053079	hsa-miR-15a-5p	Western blot	23867820
MIRT052916	hsa-miR-29a-3p	ImmunofluorescenceqRT-PCRReporter assay	22751119
MIRT053423	hsa-miR-624-3p	Microarray	23807165
MIRT021926	hsa-miR-128-3p	FlowqRT-PCRWestern blot	23019226
MIRT054372	hsa-miR-34a-5p	Luciferase reporter assayqRT-PCRWestern blot	24415058
MIRT003216	hsa-miR-10b-5p	FlowqRT-PCRWestern blot	24216130
MIRT003216	hsa-miR-10b-5p	Luciferase reporter assayqRT-PCRWestern blot	24573354
MIRT003216	hsa-miR-10b-5p	Luciferase reporter assayqRT-PCRWestern blot	24573354
MIRT054913	hsa-miR-7-5p	ImmunoblotLuciferase reporter assayqRT-PCR	23384942
MIRT054913	hsa-miR-7-5p	ImmunoblotLuciferase reporter assayqRT-PCR	23384942
MIRT054913	hsa-miR-7-5p	ImmunoblotLuciferase reporter assayqRT-PCR	23384942
MIRT000308	hsa-miR-145-5p	qRT-PCR	23312222
MIRT438357	hsa-miR-206	FlowqRT-PCR	24855559
MIRT000308	hsa-miR-145-5p	qRT-PCRWestern blot	25273883
MIRT438305	hsa-miR-152-3p	ImmunoprecipitaionqRT-PCRWestern blotLuciferase reporter assay	25218589
MIRT438305	hsa-miR-152-3p	ImmunoprecipitaionqRT-PCRWestern blotLuciferase reporter assay	25218589
MIRT438288	hsa-miR-137	Luciferase reporter assay	24084696
MIRT438288	hsa-miR-137	Luciferase reporter assay	24084696
MIRT054913	hsa-miR-7-5p	Luciferase reporter assayqRT-PCRWestern blot	24200387
MIRT054913	hsa-miR-7-5p	Luciferase reporter assayqRT-PCRWestern blot	24200387
MIRT000308	hsa-miR-145-5p	qRT-PCR	23312222
MIRT438357	hsa-miR-206	FlowqRT-PCR	24855559
MIRT000308	hsa-miR-145-5p	qRT-PCRWestern blot	25273883
MIRT438305	hsa-miR-152-3p	ImmunoprecipitaionqRT-PCRWestern blotLuciferase reporter assay	25218589
MIRT438305	hsa-miR-152-3p	ImmunoprecipitaionqRT-PCRWestern blotLuciferase reporter assay	25218589
MIRT438288	hsa-miR-137	Luciferase reporter assay	24084696
MIRT438288	hsa-miR-137	Luciferase reporter assay	24084696
MIRT054913	hsa-miR-7-5p	Luciferase reporter assayqRT-PCRWestern blot	24200387
MIRT054913	hsa-miR-7-5p	Luciferase reporter assayqRT-PCRWestern blot	24200387
MIRT003605	hsa-miR-25-3p	Luciferase reporter assay	25923408
MIRT003605	hsa-miR-25-3p	Luciferase reporter assay	25923408
MIRT000308	hsa-miR-145-5p	Luciferase reporter assayqRT-PCRWestern blot	28380435
MIRT003216	hsa-miR-10b-5p	Luciferase reporter assayqRT-PCRWestern blot	26191201
MIRT003216	hsa-miR-10b-5p	Luciferase reporter assayqRT-PCRWestern blot	26191201
MIRT732068	hsa-miR-32-5p	Luciferase reporter assayqRT-PCRWestern blot	26471298
MIRT732068	hsa-miR-32-5p	Luciferase reporter assayqRT-PCRWestern blot	26471298
MIRT000308	hsa-miR-145-5p	Northern blotqRT-PCRWestern blot	26197891
MIRT732242	hsa-miR-367-3p	Luciferase reporter assayqRT-PCRWestern blot	27335771
MIRT732242	hsa-miR-367-3p	Luciferase reporter assayqRT-PCRWestern blot	27335771
MIRT054913	hsa-miR-7-5p	Luciferase reporter assayqRT-PCRWestern blot	27431648
MIRT054913	hsa-miR-7-5p	Luciferase reporter assayqRT-PCRWestern blot	27431648
MIRT054913	hsa-miR-7-5p	Luciferase reporter assayqRT-PCRWestern blot	27431648
MIRT054913	hsa-miR-7-5p	Luciferase reporter assayqRT-PCRWestern blot	27431648
MIRT054913	hsa-miR-7-5p	Luciferase reporter assayqRT-PCRWestern blot	27431648
MIRT054913	hsa-miR-7-5p	Luciferase reporter assayqRT-PCRWestern blot	27431648
MIRT000308	hsa-miR-145-5p	Luciferase reporter assayqRT-PCRWestern blot	26181633
MIRT054372	hsa-miR-34a-5p	Luciferase reporter assayqRT-PCRWestern blot	25362853
MIRT054372	hsa-miR-34a-5p	Luciferase reporter assayqRT-PCRWestern blot	25362853
MIRT756124	hsa-miR-92a-3p	ImmunohistochemistryqRT-PCRWestern blot	27411964
MIRT756124	hsa-miR-92a-3p	ImmunohistochemistryqRT-PCRWestern blot	27411964
MIRT756124	hsa-miR-92a-3p	ImmunohistochemistryqRT-PCRWestern blot	27411964
MIRT756124	hsa-miR-92a-3p	ImmunohistochemistryqRT-PCRWestern blot	27411964
MIRT732068	hsa-miR-32-5p	ImmunohistochemistryImmunoprecipitaionLuciferase reporter assayqRT-PCRWestern blot	27871067
MIRT732068	hsa-miR-32-5p	ImmunohistochemistryImmunoprecipitaionLuciferase reporter assayqRT-PCRWestern blot	27871067
MIRT732068	hsa-miR-32-5p	ImmunohistochemistryImmunoprecipitaionLuciferase reporter assayqRT-PCRWestern blot	27871067
MIRT732068	hsa-miR-32-5p	ImmunohistochemistryImmunoprecipitaionLuciferase reporter assayqRT-PCRWestern blot	27871067
MIRT054372	hsa-miR-34a-5p	ImmunoblotqRT-PCR	28250026
MIRT005440	hsa-miR-135b-5p	qRT-PCR	26877610
MIRT006688	hsa-miR-103a-3p	FlowLuciferase reporter assayqRT-PCRWestern blot	28445396
MIRT006688	hsa-miR-103a-3p	FlowLuciferase reporter assayqRT-PCRWestern blot	28445396
MIRT003216	hsa-miR-10b-5p	Luciferase reporter assay	27669739
MIRT003216	hsa-miR-10b-5p	Luciferase reporter assay	27669739
MIRT003216	hsa-miR-10b-5p	Luciferase reporter assayWestern blot	27764757
MIRT003216	hsa-miR-10b-5p	Luciferase reporter assayWestern blot	27764757
MIRT054913	hsa-miR-7-5p	Luciferase reporter assay	26172296
MIRT054913	hsa-miR-7-5p	Luciferase reporter assay	26172296
MIRT054913	hsa-miR-7-5p	Luciferase reporter assay	26172296
MIRT054913	hsa-miR-7-5p	Luciferase reporter assay	26172296
MIRT054913	hsa-miR-7-5p	Luciferase reporter assayqRT-PCRWestern blot	28239300
MIRT054913	hsa-miR-7-5p	Luciferase reporter assayqRT-PCRWestern blot	28239300
MIRT733581	hsa-miR-92b-3p	Luciferase reporter assayqRT-PCRWestern blotting	31933825
MIRT733581	hsa-miR-92b-3p	Luciferase reporter assayqRT-PCRWestern blotting	31933825
MIRT733581	hsa-miR-92b-3p	Luciferase reporter assayqRT-PCRWestern blotting	31933825
MIRT733815	hsa-miR-451b	qRT-PCRWestern blotting	33725258
MIRT006688	hsa-miR-103a-3p	Luciferase reporter assayqRT-PCRRNA-seqWestern blotting	32061112
MIRT006692	hsa-miR-107	Western blottingqRT-PCR	32674073
MIRT733581	hsa-miR-92b-3p	Luciferase reporter assayWestern blottingqRT-PCR	31686859
MIRT053079	hsa-miR-15a-5p	qRT-PCR	32733962
MIRT006688	hsa-miR-103a-3p	Luciferase reporter assayWestern blottingRNA-seqqRT-PCR	32061112
MIRT756124	hsa-miR-92a-3p	Luciferase reporter assayWestern blottingqRT-PCR	36601739
MIRT756124	hsa-miR-92a-3p	Luciferase reporter assayWestern blottingqRT-PCR	36601739
MIRT756124	hsa-miR-92a-3p	Luciferase reporter assayWestern blottingqRT-PCR	36214716
MIRT1096516	hsa-miR-1256	CLIP-seq
MIRT1096517	hsa-miR-1263	CLIP-seq
MIRT1096518	hsa-miR-128	CLIP-seq
MIRT1096519	hsa-miR-1292	CLIP-seq
MIRT1096520	hsa-miR-1297	CLIP-seq
MIRT1096521	hsa-miR-135a	CLIP-seq
MIRT1096522	hsa-miR-135b	CLIP-seq
MIRT1096523	hsa-miR-140-3p	CLIP-seq
MIRT1096524	hsa-miR-142-3p	CLIP-seq
MIRT1096525	hsa-miR-148a	CLIP-seq
MIRT1096526	hsa-miR-148b	CLIP-seq
MIRT1096527	hsa-miR-149	CLIP-seq
MIRT1096528	hsa-miR-152	CLIP-seq
MIRT1096529	hsa-miR-186	CLIP-seq
MIRT1096530	hsa-miR-219-5p	CLIP-seq
MIRT1096531	hsa-miR-25	CLIP-seq
MIRT1096532	hsa-miR-26a	CLIP-seq
MIRT1096533	hsa-miR-26b	CLIP-seq
MIRT1096534	hsa-miR-29a	CLIP-seq
MIRT1096535	hsa-miR-29b	CLIP-seq
MIRT1096536	hsa-miR-29c	CLIP-seq
MIRT1096537	hsa-miR-3064-5p	CLIP-seq
MIRT1096538	hsa-miR-3119	CLIP-seq
MIRT1096539	hsa-miR-3120-5p	CLIP-seq
MIRT1096540	hsa-miR-3133	CLIP-seq
MIRT1096541	hsa-miR-3140-5p	CLIP-seq
MIRT1096542	hsa-miR-3154	CLIP-seq
MIRT1096543	hsa-miR-3160-5p	CLIP-seq
MIRT1096544	hsa-miR-32	CLIP-seq
MIRT1096545	hsa-miR-346	CLIP-seq
MIRT1096546	hsa-miR-363	CLIP-seq
MIRT1096547	hsa-miR-3652	CLIP-seq
MIRT1096548	hsa-miR-3667-3p	CLIP-seq
MIRT1096549	hsa-miR-367	CLIP-seq
MIRT1096550	hsa-miR-3686	CLIP-seq
MIRT1096551	hsa-miR-378g	CLIP-seq
MIRT1096552	hsa-miR-4259	CLIP-seq
MIRT1096553	hsa-miR-4272	CLIP-seq
MIRT1096554	hsa-miR-4288	CLIP-seq
MIRT1096555	hsa-miR-4302	CLIP-seq
MIRT1096556	hsa-miR-4307	CLIP-seq
MIRT1096557	hsa-miR-4425	CLIP-seq
MIRT1096558	hsa-miR-4430	CLIP-seq
MIRT1096559	hsa-miR-4432	CLIP-seq
MIRT1096560	hsa-miR-4437	CLIP-seq
MIRT1096561	hsa-miR-4445	CLIP-seq
MIRT1096562	hsa-miR-4448	CLIP-seq
MIRT1096563	hsa-miR-4457	CLIP-seq
MIRT1096564	hsa-miR-4465	CLIP-seq
MIRT1096565	hsa-miR-4471	CLIP-seq
MIRT1096566	hsa-miR-4473	CLIP-seq
MIRT1096567	hsa-miR-4494	CLIP-seq
MIRT1096568	hsa-miR-4505	CLIP-seq
MIRT1096569	hsa-miR-4642	CLIP-seq
MIRT1096570	hsa-miR-4652-3p	CLIP-seq
MIRT1096571	hsa-miR-4659a-3p	CLIP-seq
MIRT1096572	hsa-miR-4659b-3p	CLIP-seq
MIRT1096573	hsa-miR-4674	CLIP-seq
MIRT1096574	hsa-miR-4680-3p	CLIP-seq
MIRT1096575	hsa-miR-4729	CLIP-seq
MIRT1096576	hsa-miR-4744	CLIP-seq
MIRT1096577	hsa-miR-4766-5p	CLIP-seq
MIRT1096578	hsa-miR-4778-3p	CLIP-seq
MIRT1096579	hsa-miR-4782-3p	CLIP-seq
MIRT1096580	hsa-miR-4794	CLIP-seq
MIRT1096581	hsa-miR-502-5p	CLIP-seq
MIRT1096582	hsa-miR-508-3p	CLIP-seq
MIRT1096583	hsa-miR-512-3p	CLIP-seq
MIRT1096584	hsa-miR-513b	CLIP-seq
MIRT1096585	hsa-miR-516a-3p	CLIP-seq
MIRT1096586	hsa-miR-520f	CLIP-seq
MIRT1096587	hsa-miR-548a-5p	CLIP-seq
MIRT1096588	hsa-miR-548ab	CLIP-seq
MIRT1096589	hsa-miR-548ak	CLIP-seq
MIRT1096590	hsa-miR-548b-5p	CLIP-seq
MIRT1096591	hsa-miR-548c-3p	CLIP-seq
MIRT1096592	hsa-miR-548c-5p	CLIP-seq
MIRT1096593	hsa-miR-548d-5p	CLIP-seq
MIRT1096594	hsa-miR-548h	CLIP-seq
MIRT1096595	hsa-miR-548i	CLIP-seq
MIRT1096596	hsa-miR-548j	CLIP-seq
MIRT1096597	hsa-miR-548n	CLIP-seq
MIRT1096598	hsa-miR-548w	CLIP-seq
MIRT1096599	hsa-miR-548y	CLIP-seq
MIRT1096600	hsa-miR-559	CLIP-seq
MIRT1096601	hsa-miR-570	CLIP-seq
MIRT1096602	hsa-miR-591	CLIP-seq
MIRT1096603	hsa-miR-632	CLIP-seq
MIRT1096604	hsa-miR-642a	CLIP-seq
MIRT1096605	hsa-miR-665	CLIP-seq
MIRT1096606	hsa-miR-7	CLIP-seq
MIRT1096607	hsa-miR-767-5p	CLIP-seq
MIRT1096608	hsa-miR-92a	CLIP-seq
MIRT1096609	hsa-miR-92b	CLIP-seq
MIRT1096610	hsa-miR-944	CLIP-seq
MIRT1096541	hsa-miR-3140-5p	CLIP-seq
MIRT1096550	hsa-miR-3686	CLIP-seq
MIRT1096556	hsa-miR-4307	CLIP-seq
MIRT1096570	hsa-miR-4652-3p	CLIP-seq
MIRT1096571	hsa-miR-4659a-3p	CLIP-seq
MIRT1096572	hsa-miR-4659b-3p	CLIP-seq
MIRT1096574	hsa-miR-4680-3p	CLIP-seq
MIRT1096578	hsa-miR-4778-3p	CLIP-seq
MIRT2026106	hsa-miR-1	CLIP-seq
MIRT2026107	hsa-miR-1200	CLIP-seq
MIRT2026108	hsa-miR-200b	CLIP-seq
MIRT2026109	hsa-miR-200c	CLIP-seq
MIRT1096531	hsa-miR-25	CLIP-seq
MIRT2026110	hsa-miR-3074-5p	CLIP-seq
MIRT1096539	hsa-miR-3120-5p	CLIP-seq
MIRT1096541	hsa-miR-3140-5p	CLIP-seq
MIRT1096544	hsa-miR-32	CLIP-seq
MIRT1096546	hsa-miR-363	CLIP-seq
MIRT1096549	hsa-miR-367	CLIP-seq
MIRT2026111	hsa-miR-3673	CLIP-seq
MIRT1096550	hsa-miR-3686	CLIP-seq
MIRT2026112	hsa-miR-3920	CLIP-seq
MIRT1096552	hsa-miR-4259	CLIP-seq
MIRT2026113	hsa-miR-429	CLIP-seq
MIRT1096556	hsa-miR-4307	CLIP-seq
MIRT2026114	hsa-miR-4320	CLIP-seq
MIRT1096563	hsa-miR-4457	CLIP-seq
MIRT1096570	hsa-miR-4652-3p	CLIP-seq
MIRT1096571	hsa-miR-4659a-3p	CLIP-seq
MIRT1096572	hsa-miR-4659b-3p	CLIP-seq
MIRT1096574	hsa-miR-4680-3p	CLIP-seq
MIRT2026115	hsa-miR-4704-3p	CLIP-seq
MIRT2026116	hsa-miR-4724-5p	CLIP-seq
MIRT1096578	hsa-miR-4778-3p	CLIP-seq
MIRT1096581	hsa-miR-502-5p	CLIP-seq
MIRT2026117	hsa-miR-511	CLIP-seq
MIRT1096584	hsa-miR-513b	CLIP-seq
MIRT2026118	hsa-miR-613	CLIP-seq
MIRT2026119	hsa-miR-656	CLIP-seq
MIRT1096606	hsa-miR-7	CLIP-seq
MIRT1096608	hsa-miR-92a	CLIP-seq
MIRT1096609	hsa-miR-92b	CLIP-seq
MIRT2257183	hsa-miR-1206	CLIP-seq
MIRT2257184	hsa-miR-1236	CLIP-seq
MIRT1096529	hsa-miR-186	CLIP-seq
MIRT2026108	hsa-miR-200b	CLIP-seq
MIRT2026109	hsa-miR-200c	CLIP-seq
MIRT1096531	hsa-miR-25	CLIP-seq
MIRT1096534	hsa-miR-29a	CLIP-seq
MIRT1096535	hsa-miR-29b	CLIP-seq
MIRT1096536	hsa-miR-29c	CLIP-seq
MIRT1096539	hsa-miR-3120-5p	CLIP-seq
MIRT2257185	hsa-miR-3128	CLIP-seq
MIRT1096540	hsa-miR-3133	CLIP-seq
MIRT2257186	hsa-miR-3182	CLIP-seq
MIRT1096544	hsa-miR-32	CLIP-seq
MIRT1096545	hsa-miR-346	CLIP-seq
MIRT2257187	hsa-miR-34a	CLIP-seq
MIRT2257188	hsa-miR-34c-5p	CLIP-seq
MIRT1096546	hsa-miR-363	CLIP-seq
MIRT1096549	hsa-miR-367	CLIP-seq
MIRT2257189	hsa-miR-3674	CLIP-seq
MIRT1096552	hsa-miR-4259	CLIP-seq
MIRT1096554	hsa-miR-4288	CLIP-seq
MIRT2026113	hsa-miR-429	CLIP-seq
MIRT1096555	hsa-miR-4302	CLIP-seq
MIRT1096559	hsa-miR-4432	CLIP-seq
MIRT2257190	hsa-miR-4452	CLIP-seq
MIRT1096567	hsa-miR-4494	CLIP-seq
MIRT2257191	hsa-miR-449a	CLIP-seq
MIRT2257192	hsa-miR-449b	CLIP-seq
MIRT1096574	hsa-miR-4680-3p	CLIP-seq
MIRT2257193	hsa-miR-4698	CLIP-seq
MIRT2257194	hsa-miR-4703-3p	CLIP-seq
MIRT2257195	hsa-miR-4720-5p	CLIP-seq
MIRT2026116	hsa-miR-4724-5p	CLIP-seq
MIRT1096575	hsa-miR-4729	CLIP-seq
MIRT1096576	hsa-miR-4744	CLIP-seq
MIRT2257196	hsa-miR-4753-3p	CLIP-seq
MIRT1096577	hsa-miR-4766-5p	CLIP-seq
MIRT2257197	hsa-miR-4799-3p	CLIP-seq
MIRT1096581	hsa-miR-502-5p	CLIP-seq
MIRT2257198	hsa-miR-520d-5p	CLIP-seq
MIRT2257199	hsa-miR-524-5p	CLIP-seq
MIRT1096587	hsa-miR-548a-5p	CLIP-seq
MIRT1096588	hsa-miR-548ab	CLIP-seq
MIRT1096589	hsa-miR-548ak	CLIP-seq
MIRT1096590	hsa-miR-548b-5p	CLIP-seq
MIRT1096591	hsa-miR-548c-3p	CLIP-seq
MIRT1096592	hsa-miR-548c-5p	CLIP-seq
MIRT1096593	hsa-miR-548d-5p	CLIP-seq
MIRT1096594	hsa-miR-548h	CLIP-seq
MIRT1096595	hsa-miR-548i	CLIP-seq
MIRT1096596	hsa-miR-548j	CLIP-seq
MIRT1096597	hsa-miR-548n	CLIP-seq
MIRT1096598	hsa-miR-548w	CLIP-seq
MIRT1096599	hsa-miR-548y	CLIP-seq
MIRT1096600	hsa-miR-559	CLIP-seq
MIRT2257200	hsa-miR-579	CLIP-seq
MIRT1096603	hsa-miR-632	CLIP-seq
MIRT1096606	hsa-miR-7	CLIP-seq
MIRT1096607	hsa-miR-767-5p	CLIP-seq
MIRT1096608	hsa-miR-92a	CLIP-seq
MIRT1096609	hsa-miR-92b	CLIP-seq
MIRT1096610	hsa-miR-944	CLIP-seq
MIRT1096518	hsa-miR-128	CLIP-seq
MIRT1096523	hsa-miR-140-3p	CLIP-seq
MIRT1096525	hsa-miR-148a	CLIP-seq
MIRT1096526	hsa-miR-148b	CLIP-seq
MIRT1096528	hsa-miR-152	CLIP-seq
MIRT1096539	hsa-miR-3120-5p	CLIP-seq
MIRT1096545	hsa-miR-346	CLIP-seq
MIRT1096554	hsa-miR-4288	CLIP-seq
MIRT1096567	hsa-miR-4494	CLIP-seq
MIRT1096603	hsa-miR-632	CLIP-seq
MIRT2026107	hsa-miR-1200	CLIP-seq
MIRT1096518	hsa-miR-128	CLIP-seq
MIRT1096519	hsa-miR-1292	CLIP-seq
MIRT1096523	hsa-miR-140-3p	CLIP-seq
MIRT1096524	hsa-miR-142-3p	CLIP-seq
MIRT1096525	hsa-miR-148a	CLIP-seq
MIRT1096526	hsa-miR-148b	CLIP-seq
MIRT1096527	hsa-miR-149	CLIP-seq
MIRT1096528	hsa-miR-152	CLIP-seq
MIRT1096529	hsa-miR-186	CLIP-seq
MIRT2558520	hsa-miR-2116	CLIP-seq
MIRT1096530	hsa-miR-219-5p	CLIP-seq
MIRT1096537	hsa-miR-3064-5p	CLIP-seq
MIRT2026110	hsa-miR-3074-5p	CLIP-seq
MIRT1096539	hsa-miR-3120-5p	CLIP-seq
MIRT1096540	hsa-miR-3133	CLIP-seq
MIRT1096543	hsa-miR-3160-5p	CLIP-seq
MIRT1096545	hsa-miR-346	CLIP-seq
MIRT1096547	hsa-miR-3652	CLIP-seq
MIRT1096548	hsa-miR-3667-3p	CLIP-seq
MIRT1096551	hsa-miR-378g	CLIP-seq
MIRT2026112	hsa-miR-3920	CLIP-seq
MIRT2558521	hsa-miR-409-3p	CLIP-seq
MIRT1096552	hsa-miR-4259	CLIP-seq
MIRT1096554	hsa-miR-4288	CLIP-seq
MIRT2026114	hsa-miR-4320	CLIP-seq
MIRT1096557	hsa-miR-4425	CLIP-seq
MIRT1096558	hsa-miR-4430	CLIP-seq
MIRT1096560	hsa-miR-4437	CLIP-seq
MIRT1096561	hsa-miR-4445	CLIP-seq
MIRT1096562	hsa-miR-4448	CLIP-seq
MIRT1096563	hsa-miR-4457	CLIP-seq
MIRT1096565	hsa-miR-4471	CLIP-seq
MIRT1096566	hsa-miR-4473	CLIP-seq
MIRT1096567	hsa-miR-4494	CLIP-seq
MIRT1096568	hsa-miR-4505	CLIP-seq
MIRT1096573	hsa-miR-4674	CLIP-seq
MIRT2558522	hsa-miR-4677-5p	CLIP-seq
MIRT1096576	hsa-miR-4744	CLIP-seq
MIRT1096579	hsa-miR-4782-3p	CLIP-seq
MIRT1096580	hsa-miR-4794	CLIP-seq
MIRT1096582	hsa-miR-508-3p	CLIP-seq
MIRT2026117	hsa-miR-511	CLIP-seq
MIRT1096583	hsa-miR-512-3p	CLIP-seq
MIRT1096584	hsa-miR-513b	CLIP-seq
MIRT1096586	hsa-miR-520f	CLIP-seq
MIRT1096591	hsa-miR-548c-3p	CLIP-seq
MIRT2558523	hsa-miR-556-3p	CLIP-seq
MIRT1096602	hsa-miR-591	CLIP-seq
MIRT1096603	hsa-miR-632	CLIP-seq
MIRT1096604	hsa-miR-642a	CLIP-seq
MIRT2026119	hsa-miR-656	CLIP-seq
MIRT1096606	hsa-miR-7	CLIP-seq
MIRT1096518	hsa-miR-128	CLIP-seq
MIRT1096523	hsa-miR-140-3p	CLIP-seq
MIRT1096525	hsa-miR-148a	CLIP-seq
MIRT1096526	hsa-miR-148b	CLIP-seq
MIRT1096528	hsa-miR-152	CLIP-seq
MIRT1096529	hsa-miR-186	CLIP-seq
MIRT2558520	hsa-miR-2116	CLIP-seq
MIRT1096539	hsa-miR-3120-5p	CLIP-seq
MIRT1096540	hsa-miR-3133	CLIP-seq
MIRT1096545	hsa-miR-346	CLIP-seq
MIRT1096554	hsa-miR-4288	CLIP-seq
MIRT2026114	hsa-miR-4320	CLIP-seq
MIRT1096567	hsa-miR-4494	CLIP-seq
MIRT2558522	hsa-miR-4677-5p	CLIP-seq
MIRT1096576	hsa-miR-4744	CLIP-seq
MIRT2026117	hsa-miR-511	CLIP-seq
MIRT1096591	hsa-miR-548c-3p	CLIP-seq
MIRT2558523	hsa-miR-556-3p	CLIP-seq
MIRT1096603	hsa-miR-632	CLIP-seq
MIRT2026119	hsa-miR-656	CLIP-seq

Show/Hide all (11)

Transcription factor	Regulation	Reference
APC	Unknown	12387883
CDX2	Activation	11521200
CDX2	Unknown	23202735
HDAC1	Repression	15051827
HDAC2	Repression	19486889
HDAC4	Unknown	21118993
PPARG	Unknown	23275339
RUNX1	Unknown	19328795
SOX9	Unknown	18977346
TCF4	Unknown	18977346
TP63	Repression	20972454

117

Show/Hide all (117)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000122	Process	Negative regulation of transcription by RNA polymerase II	IDA	20551324
GO:0000785	Component	Chromatin	IDA	21539536
GO:0000785	Component	Chromatin	IEA
GO:0000785	Component	Chromatin	ISA
GO:0000791	Component	Euchromatin	IEA
GO:0000976	Function	Transcription cis-regulatory region binding	IEA
GO:0000976	Function	Transcription cis-regulatory region binding	ISS
GO:0000978	Function	RNA polymerase II cis-regulatory region sequence-specific DNA binding	IBA
GO:0000978	Function	RNA polymerase II cis-regulatory region sequence-specific DNA binding	IDA	20629177, 21539536
GO:0000978	Function	RNA polymerase II cis-regulatory region sequence-specific DNA binding	IEA
GO:0000981	Function	DNA-binding transcription factor activity, RNA polymerase II-specific	IBA
GO:0000981	Function	DNA-binding transcription factor activity, RNA polymerase II-specific	IEA
GO:0000981	Function	DNA-binding transcription factor activity, RNA polymerase II-specific	ISA
GO:0001010	Function	RNA polymerase II sequence-specific DNA-binding transcription factor recruiting activity	IEA
GO:0001010	Function	RNA polymerase II sequence-specific DNA-binding transcription factor recruiting activity	ISS
GO:0001221	Function	Transcription coregulator binding	IEA
GO:0001228	Function	DNA-binding transcription activator activity, RNA polymerase II-specific	IEA
GO:0001228	Function	DNA-binding transcription activator activity, RNA polymerase II-specific	IMP	21539536
GO:0002357	Process	Defense response to tumor cell	IMP	30429596
GO:0003677	Function	DNA binding	IEA
GO:0003690	Function	Double-stranded DNA binding	IEA
GO:0003700	Function	DNA-binding transcription factor activity	IDA	20629177
GO:0003700	Function	DNA-binding transcription factor activity	IEA
GO:0003700	Function	DNA-binding transcription factor activity	NAS	9422764
GO:0003700	Function	DNA-binding transcription factor activity	TAS	10431239
GO:0005515	Function	Protein binding	IPI	19751731, 24048479, 32296183
GO:0005634	Component	Nucleus	IEA
GO:0005654	Component	Nucleoplasm	IDA
GO:0005654	Component	Nucleoplasm	TAS
GO:0005667	Component	Transcription regulator complex	IEA
GO:0005737	Component	Cytoplasm	IEA
GO:0005829	Component	Cytosol	IDA
GO:0006351	Process	DNA-templated transcription	IEA
GO:0006357	Process	Regulation of transcription by RNA polymerase II	IBA
GO:0006357	Process	Regulation of transcription by RNA polymerase II	IEA
GO:0006366	Process	Transcription by RNA polymerase II	IEA
GO:0007500	Process	Mesodermal cell fate determination	TAS	8940147
GO:0008013	Function	Beta-catenin binding	IEA
GO:0008270	Function	Zinc ion binding	IEA
GO:0008270	Function	Zinc ion binding	NAS	9422764
GO:0008285	Process	Negative regulation of cell population proliferation	IEA
GO:0008285	Process	Negative regulation of cell population proliferation	TAS	8702718
GO:0008544	Process	Epidermis development	IEA
GO:0009913	Process	Epidermal cell differentiation	IEA
GO:0010467	Process	Gene expression	IEA
GO:0010628	Process	Positive regulation of gene expression	IGI	22267480
GO:0010629	Process	Negative regulation of gene expression	IGI	22267480
GO:0014740	Process	Negative regulation of muscle hyperplasia	IEA
GO:0015630	Component	Microtubule cytoskeleton	IDA
GO:0016525	Process	Negative regulation of angiogenesis	IDA	23867820
GO:0019827	Process	Stem cell population maintenance	IEA
GO:0019827	Process	Stem cell population maintenance	ISS
GO:0030336	Process	Negative regulation of cell migration	IEA
GO:0030855	Process	Epithelial cell differentiation	IEA
GO:0031077	Process	Post-embryonic camera-type eye development	IEA
GO:0031490	Function	Chromatin DNA binding	IEA
GO:0032206	Process	Positive regulation of telomere maintenance	IDA	20629177
GO:0032526	Process	Response to retinoic acid	IEA
GO:0032717	Process	Negative regulation of interleukin-8 production	IDA	20551324
GO:0034115	Process	Negative regulation of heterotypic cell-cell adhesion	IDA	20551324
GO:0035014	Function	Phosphatidylinositol 3-kinase regulator activity	IEA
GO:0035019	Process	Somatic stem cell population maintenance	IEA
GO:0035166	Process	Post-embryonic hemopoiesis	IMP	21539536
GO:0042127	Process	Regulation of cell population proliferation	IEA
GO:0042826	Function	Histone deacetylase binding	IEA
GO:0043124	Process	Negative regulation of canonical NF-kappaB signal transduction	IDA	20551324
GO:0043565	Function	Sequence-specific DNA binding	IEA
GO:0045429	Process	Positive regulation of nitric oxide biosynthetic process	IMP	22430140
GO:0045444	Process	Fat cell differentiation	IEA
GO:0045444	Process	Fat cell differentiation	ISS
GO:0045595	Process	Regulation of cell differentiation	IEA
GO:0045595	Process	Regulation of cell differentiation	ISS
GO:0045892	Process	Negative regulation of DNA-templated transcription	IDA	9422764
GO:0045892	Process	Negative regulation of DNA-templated transcription	IEA
GO:0045893	Process	Positive regulation of DNA-templated transcription	IDA	27431648
GO:0045893	Process	Positive regulation of DNA-templated transcription	IEA
GO:0045893	Process	Positive regulation of DNA-templated transcription	ISS
GO:0045893	Process	Positive regulation of DNA-templated transcription	NAS	9422764
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	IDA	20629177
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	IEA
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	IEA
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	IGI	20551324
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	IMP	22430140, 22723415, 27907090
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	ISS
GO:0046872	Function	Metal ion binding	IEA
GO:0046985	Process	Positive regulation of hemoglobin biosynthetic process	IMP	21539536
GO:0048662	Process	Negative regulation of smooth muscle cell proliferation	IEA
GO:0048679	Process	Regulation of axon regeneration	IEA
GO:0048730	Process	Epidermis morphogenesis	IEA
GO:0050728	Process	Negative regulation of inflammatory response	TAS	20551324
GO:0051247	Process	Positive regulation of protein metabolic process	IGI	20551324
GO:0051247	Process	Positive regulation of protein metabolic process	IMP	22430140
GO:0051898	Process	Negative regulation of phosphatidylinositol 3-kinase/protein kinase B signal transduction	IEA
GO:0060070	Process	Canonical Wnt signaling pathway	IEA
GO:0060761	Process	Negative regulation of response to cytokine stimulus	IDA	20551324
GO:0061436	Process	Establishment of skin barrier	IEA
GO:0061629	Function	RNA polymerase II-specific DNA-binding transcription factor binding	IEA
GO:0061629	Function	RNA polymerase II-specific DNA-binding transcription factor binding	IPI	21539536
GO:0061629	Function	RNA polymerase II-specific DNA-binding transcription factor binding	ISS
GO:0070301	Process	Cellular response to hydrogen peroxide	IEA
GO:0070373	Process	Negative regulation of ERK1 and ERK2 cascade	IEA
GO:0071300	Process	Cellular response to retinoic acid	IEA
GO:0071363	Process	Cellular response to growth factor stimulus	IDA	20551324
GO:0071499	Process	Cellular response to laminar fluid shear stress	IMP	22430140
GO:0090051	Process	Negative regulation of cell migration involved in sprouting angiogenesis	IDA	20551324
GO:0106222	Function	LncRNA binding	IEA
GO:0120222	Process	Regulation of blastocyst development	IEA
GO:1902895	Process	Positive regulation of miRNA transcription	IDA	23867820
GO:1903672	Process	Positive regulation of sprouting angiogenesis	IGI	27431648
GO:1904998	Process	Negative regulation of leukocyte adhesion to arterial endothelial cell	IGI	22267480
GO:1990830	Process	Cellular response to leukemia inhibitory factor	IEA
GO:1990837	Function	Sequence-specific double-stranded DNA binding	IDA	28473536
GO:1990841	Function	Promoter-specific chromatin binding	IDA	27907090
GO:1990859	Process	Cellular response to endothelin	IEA
GO:2000134	Process	Negative regulation of G1/S transition of mitotic cell cycle	IDA	23867820
GO:2000342	Process	Negative regulation of chemokine (C-X-C motif) ligand 2 production	IDA	20551324
GO:2001240	Process	Negative regulation of extrinsic apoptotic signaling pathway in absence of ligand	IDA	20551324

MIM	HGNC	e!Ensembl
602253	6348	ENSG00000136826

O43474

Protein name

Krueppel-like factor 4 (Epithelial zinc finger protein EZF) (Gut-enriched krueppel-like factor)

Protein function

Transcription factor; can act both as activator and as repressor. Binds the 5'-CACCC-3' core sequence. Binds to the promoter region of its own gene and can activate its own transcription. Regulates the expression of key transcription factors dur

PDB

6VTX

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00096	zf-C2H2	430 → 454	Zinc finger, C2H2 type	Domain
PF00096	zf-C2H2	460 → 484	Zinc finger, C2H2 type	Domain
PF00096	zf-C2H2	490 → 512	Zinc finger, C2H2 type	Domain

Sequence

MRQPPGESDMAVSDALLPSFSTFASGPAGREKTLRQAGAPNNRWREELSHMKRLPPVLPG
RPYDLAAATVATDLESGGAGAACGGSNLAPLPRRETEEFNDLLDLDFILSNSLTHPPESV
AATVSSSASASSSSSPSSSGPASAPSTCSFTYPIRAGNDPGVAPGGTGGGLLYGRESAPP
PTAPFNLADINDVSPSGGFVAELLRPELDPVYIPPQQPQPPGGGLMGKFVLKASLSAPGS
EYGSPSVISVSKGSPDGSHPVVVAPYNGGPPRTCPKIKQEAVSSCTHLGAGPPLSNGHRP
AAHDFPLGRQLPSRTTPTLGLEEVLSSRDCHPALPLPPGFHPHPGPNYPSFLPDQMQPQV
PPLHYQGQSRGFVARAGEPCVCWPHFGTHGMMLTPPSSPLELMPPGSCMPEEPKPKRGRR
SWPRKRTATHTCDYAGCGKTYTKSSHLKAHLRTHTGEKPYHCDWDGCGWKFARSDELTRH
YRKHTGHRPFQCQKCDRAFSRSDHLALHMKRHF

Sequence length

513

Interactions

View interactions

	KEGG		Reactome
	Signaling pathways regulating pluripotency of stem cells Chemical carcinogenesis - receptor activation		Synthesis, secretion, and deacylation of Ghrelin Transcriptional regulation of pluripotent stem cells

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (20)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
ARTHRITIS, JUVENILE	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BREAST CANCER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BREAST CARCINOMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CHAGAS CARDIOMYOPATHY	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CONGENITAL ABNORMALITIES	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CONGENITAL ABNORMALITY	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CONGENITAL HEART DEFECTS	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Familial cancer of breast	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Gastric cancer	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HEART DEFECTS, CONGENITAL	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hepatocellular carcinoma	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
JUVENILE CHRONIC POLYARTHRITIS	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
KLF4-related disorder	Uncertain significance; Benign; Likely benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MONOARTICULAR JUVENILE RHEUMATOID ARTHRITIS	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MYOCARDIAL ISCHEMIA	—	CTD, Disgenet CTD, Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PAUCIARTICULAR JUVENILE RHEUMATOID ARTHRITIS	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PROSTATE CANCER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PROSTATE CARCINOMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
THROMBOSIS	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Uterine carcinosarcoma	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (354)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Acute lymphocytic leukemia	Lymphocytic Leukemia	BEFREE	25037230		★★★★★ ★☆☆☆☆ Found in Text Mining only
Acute monocytic leukemia	Monocytic Leukemia	BEFREE	22592916		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenocarcinoma	Adenocarcinoma	BEFREE	17614846		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of lung (disorder)	Lung adenocarcinoma	BEFREE	29151932, 31748695		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenoma	Adenoma	BEFREE	17614846, 17908689, 18264726, 19074836, 23729655, 26839262		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenoma of large intestine	Colorectal adenoma	BEFREE	18264726		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenomatous Polyposis Coli	Multiple polyposis syndrome	BEFREE	11521200, 12776194		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adrenoleukodystrophy	Adrenoleukodystrophy	Pubtator	29065337	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Adult Medulloblastoma	Medulloblastoma	BEFREE	20072650		★★★★★ ★☆☆☆☆ Found in Text Mining only
Alzheimer Disease	Alzheimer disease	Pubtator	29753274, 31401456, 31698192, 37549144	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Ameloblastoma	Ameloblastoma	Pubtator	37559082	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Amyotrophic Lateral Sclerosis	Amyotrophic Lateral Sclerosis	BEFREE	22673189		★★★★★ ★☆☆☆☆ Found in Text Mining only
Anaplasia	Anaplasia	BEFREE	22286766, 23635876, 26097551, 30205175, 30578299, 31356991		★★★★★ ★☆☆☆☆ Found in Text Mining only
Anaplastic astrocytoma	Anaplastic Astrocytoma	BEFREE	26227255		★★★★★ ★☆☆☆☆ Found in Text Mining only
Anaplastic thyroid carcinoma	Anaplastic thyroid cancer	BEFREE	28920531		★★★★★ ★☆☆☆☆ Found in Text Mining only
Aneurysm	Aneurysm	Pubtator	27720318, 30792063	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
ANOPHTHALMIA AND PULMONARY HYPOPLASIA	Syndromic microphthalmia	BEFREE	21412023, 26880805, 27449499, 27802195, 28849150		★★★★★ ★☆☆☆☆ Found in Text Mining only
Anophthalmia with pulmonary hypoplasia	Anophthalmia	Pubtator	27802195	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Aortic Aneurysm	Aortic Aneurysm	BEFREE	24030402, 31623405		★★★★★ ★☆☆☆☆ Found in Text Mining only
Aortic Aneurysm Abdominal	Aortic aneurysm	Pubtator	39321955	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Aortic Aneurysm Thoracic	Thoracic aortic aneurysm	Pubtator	35563123	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Aortic Aneurysm, Abdominal	Aortic Aneurysm	BEFREE	24030402, 31071332		★★★★★ ★☆☆☆☆ Found in Text Mining only
Aortic Aneurysm, Thoracic	Aortic Aneurysm	BEFREE	31623405		★★★★★ ★☆☆☆☆ Found in Text Mining only
Arteriosclerosis	Arteriosclerosis	BEFREE	20718868, 26372274, 26837267, 28794002, 30659837, 30809154, 30870679, 30905197, 31028566, 31222221		★★★★★ ★☆☆☆☆ Found in Text Mining only
Arthritis	Arthritis	BEFREE	29997611		★★★★★ ★☆☆☆☆ Found in Text Mining only
Arthritis Rheumatoid	Rheumatoid arthritis	Pubtator	27413250	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Asthma	Asthma	BEFREE	28867182		★★★★★ ★☆☆☆☆ Found in Text Mining only
Astrocytoma	Astrocytoma	BEFREE	24037901		★★★★★ ★☆☆☆☆ Found in Text Mining only
Atherosclerosis	Atherosclerosis	BEFREE	20718868, 26372274, 26837267, 28794002, 30659837, 30809154, 30870679, 30905197, 31028566, 31222221		★★★★★ ★☆☆☆☆ Found in Text Mining only
Atherosclerosis	Atherosclerosis	Pubtator	20718868, 36470917, 40362576	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Autism Spectrum Disorder	Autism	Pubtator	34438162	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
B-Cell Lymphomas	B-Cell Lymphoma	BEFREE	20401760, 20519630, 25789974, 30664155, 31040909		★★★★★ ★☆☆☆☆ Found in Text Mining only
Barrett Epithelium	Barrett Epithelium	BEFREE	21193454, 27693253		★★★★★ ★☆☆☆☆ Found in Text Mining only
Barrett Esophagus	Barrett esophagus	BEFREE	25558829, 28751461		★★★★★ ★☆☆☆☆ Found in Text Mining only
Barrett Esophagus	Barrett esophagus	Pubtator	25558829, 28751461	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Benign Prostatic Hyperplasia	Benign Prostatic Hyperplasia	BEFREE	11967953, 23089465		★★★★★ ★☆☆☆☆ Found in Text Mining only
Bladder Neoplasm	Bladder Neoplasm	BEFREE	12901861, 24573354, 25109409, 26729194, 28380435		★★★★★ ★☆☆☆☆ Found in Text Mining only
Bone neoplasms	Bone neoplasms	BEFREE	31239516		★★★★★ ★☆☆☆☆ Found in Text Mining only
Bowen's Disease		Pubtator	18376139	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Brain Neoplasms	Brain neoplasms	Pubtator	26689941	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast adenocarcinoma	Breast Adenocarcinoma	BEFREE	24931170		★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	11103818, 19503094, 21242971, 21586797, 21750654, 22751119, 23384942, 23926105, 24931170, 25127259, 25789974, 25879941, 26420673, 26729194, 27300169 View all (12 more)		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Breast Neoplasms	Breast neoplasm	Pubtator	11551969, 18376139, 21242971, 21586797, 21674249, 22389506, 23926105, 25879941, 26420673, 26729194, 26840086, 27323810, 28422735, 28423718, 29782654 View all (6 more)	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	20356845, 31640084	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Bronchopulmonary Dysplasia	Bronchopulmonary dysplasia	Pubtator	35950640	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Burkitt Lymphoma	Burkitt`s Lymphoma	BEFREE	20519630		★★★★★ ★☆☆☆☆ Found in Text Mining only
Burkitt Lymphoma	Burkitt lymphoma	Pubtator	26431332	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cancer of Digestive System	Gastric Cancer	BEFREE	29062163		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinogenesis	Carcinogenesis	Pubtator	12387883	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinogenesis	Carcinogenesis	Pubtator	16046710, 16357509, 20356845, 20699379, 21242971, 22284679, 22389506, 24551169, 25169491, 26420673, 26934576, 27131314, 29665649, 31653828, 32126149, 37243389, 39986058 View all (2 more)	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinogenesis	Carcinogenesis	Pubtator	21242971, 34440860	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoid Tumor	Carcinoid tumor	Pubtator	24978920	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma	Carcinoma	BEFREE	22170594, 24551169, 25292057, 26097551, 30540935, 31198634		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Embryonal	Embryonal carcinoma	Pubtator	25464862	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	24897024, 26540347, 27102441, 27728962, 27894081, 27909734, 28028181, 28192402, 29252002, 29425759, 30664155, 30672133, 31127852, 31182916, 31543683, 31653828, 32350244, 32756012 View all (3 more)	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	34114341	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma in Situ	Carcinoma in situ	Pubtator	21674249	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma in Situ	Carcinoma in situ	Pubtator	22170594	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma in situ of uterine cervix	Cervical Intraepithelial Neoplasia	BEFREE	22170594		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Intraductal Noninfiltrating	Intraductal noninfiltrating carcinoma	Pubtator	33452133	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma of bladder	Bladder carcinoma	BEFREE	12901861, 24573354, 25109409, 26729194, 28380435		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma of lung	Lung carcinoma	BEFREE	19737957, 20215880, 23440423, 26113043, 27153563, 27296948, 28631556, 28942831, 29789534, 30606669, 31119790, 31748695		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Pancreatic Ductal	Pancreatic ductal carcinoma	Pubtator	21224073	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Renal Cell	Renal cell carcinoma	Pubtator	21982273	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Renal Cell	Renal cell carcinoma	Pubtator	35585131, 36214716	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Squamous Cell	Squamous cell carcinoma	Pubtator	18376139, 26934576, 28639905	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma, Basal Cell	Carcinoma	BEFREE	22491752		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma, Ovarian Epithelial	Ovarian Epithelial carcinoma	BEFREE	25137052, 31514068		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma, Pancreatic Ductal	Pancreatic Ductal Carcinoma	BEFREE	21224073		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cardiomyopathy, Familial Idiopathic	Cardiomyopathy	BEFREE	30520133		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cardiovascular Diseases	Cardiovascular disease	Pubtator	24184689	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
cervical cancer	Cervical Cancer	BEFREE	22170594, 24551169, 28639905		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cervix carcinoma	Cervix carcinoma	BEFREE	22170594, 24551169, 28639905		★★★★★ ★☆☆☆☆ Found in Text Mining only
Childhood Acute Lymphoblastic Leukemia	Lymphoblastic Leukemia	BEFREE	25037230		★★★★★ ★☆☆☆☆ Found in Text Mining only
Childhood Medulloblastoma	Medulloblastoma	BEFREE	20072650		★★★★★ ★☆☆☆☆ Found in Text Mining only
Chronic Kidney Diseases	Kidney Disease	BEFREE	31800161		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colitis	Colitis	BEFREE	30108164, 30585268		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colitis Ulcerative	Ulcerative colitis	Pubtator	35733095	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Colon Carcinoma	Colon Carcinoma	BEFREE	11521200, 12776194, 15051827, 16077033, 18977346, 20699379, 21531817, 22170051, 22284679, 23418515, 29498307, 29794245, 30716337		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colonic Diseases	Colonic disease	Pubtator	11005769, 11521200	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Colonic Neoplasms	Colonic Neoplasms	LHGDN	12297499, 12776194		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colonic Neoplasms	Colonic Neoplasms	BEFREE	21531817, 23729655, 28289824		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colonic Neoplasms	Colonic neoplasm	Pubtator	32428045	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	14724568, 16219632, 16507986, 18264726, 20385121, 22205615, 22593189, 22703586, 23173124, 24281002, 25060774, 27131314, 27783989, 27931284, 28218782 View all (10 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	10908361, 12387883, 18376139, 20699379, 22284679, 25060774, 28218782	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal Neoplasms	LHGDN	11521200, 14724568, 16507986, 18264726, 19074836		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	14724568, 15051827, 19551868, 22389506, 22703586, 27131314, 28710230, 29197895, 29794245, 30287917, 31032663, 31169949, 31830379, 32012389, 32802869 View all (4 more)	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Congenital chromosomal disease	Congenital Chromosomal Disease	BEFREE	26644403		★★★★★ ★☆☆☆☆ Found in Text Mining only
Congenital Heart Defects	Congenital heart defects	CTD_human_DG	20439457		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Conventional (Clear Cell) Renal Cell Carcinoma	Renal Carcinoma	BEFREE	23722653, 23861801		★★★★★ ★☆☆☆☆ Found in Text Mining only
Coronary Arteriosclerosis	Coronary Arteriosclerosis	BEFREE	26214161, 31153870		★★★★★ ★☆☆☆☆ Found in Text Mining only
Coronary Artery Disease	Coronary artery disease	BEFREE	26214161, 31153870		★★★★★ ★☆☆☆☆ Found in Text Mining only
Coronary heart disease	Coronary Heart Disease	BEFREE	26214161, 31153870		★★★★★ ★☆☆☆☆ Found in Text Mining only
Coronary Restenosis	Coronary restenosis	Pubtator	36601739	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cryptorchidism	Cryptorchidism	Pubtator	23025704	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cyclical vomiting syndrome (disorder)	Cyclical Vomiting Syndrome	BEFREE	28893694		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cystic Fibrosis	Cystic fibrosis	Pubtator	32630830	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cystic Fibrosis	Cystic fibrosis	Pubtator	32777768, 32937756, 36067639	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Degenerative polyarthritis	Arthritis	BEFREE	27413250		★★★★★ ★☆☆☆☆ Found in Text Mining only
Dermatomyositis	Dermatomyositis	Pubtator	24288551	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes	Diabetes	BEFREE	29574754, 31829402		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes Mellitus	BEFREE	29574754, 31829402		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes mellitus	Pubtator	39321955	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus Type 2	Diabetes mellitus, type 2	Pubtator	37028179	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Non-Insulin-Dependent	Diabetes Mellitus	BEFREE	17688680, 31495395, 31829402		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetic Angiopathies	Diabetic cardiomyopathy	BEFREE	29574754		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetic Cardiomyopathies	Diabetic cardiomyopathy	BEFREE	30520133		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetic Nephropathies	Diabetic neuropathy	Pubtator	34735495	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetic Nephropathy	Diabetic Nephropathy	BEFREE	31432191, 31495395		★★★★★ ★☆☆☆☆ Found in Text Mining only
Down Syndrome	Down syndrome	Pubtator	33220594	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Ductal Carcinoma	Ductal Carcinoma	LHGDN	15102675		★★★★★ ★☆☆☆☆ Found in Text Mining only
Dyslipidemias	Dyslipidemias	Pubtator	27199507	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Ectodermal Dysplasia	Ectodermal Dysplasia	BEFREE	28589954		★★★★★ ★☆☆☆☆ Found in Text Mining only
Endocrine System Diseases	Endocrine system disease	Pubtator	32084531	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Endometrial Carcinoma	Endometrial carcinoma	BEFREE	30221668		★★★★★ ★☆☆☆☆ Found in Text Mining only
Endometrial Hyperplasia	Endometrial Hyperplasia	BEFREE	30221668		★★★★★ ★☆☆☆☆ Found in Text Mining only
Endometrial Hyperplasia	Endometrial hyperplasia	Pubtator	30221668	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Endometrial Neoplasms	Endometrial neoplasm	Pubtator	21543766, 21851624, 30221668	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Endometrial Neoplasms	Endometrial neoplasm	Pubtator	27098518	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Epidermolysis bullosa simplex Ogna type	Epidermolysis bullosa	Pubtator	28675510	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Epithelioma	Epithelioma	BEFREE	21132436		★★★★★ ★☆☆☆☆ Found in Text Mining only
Esophageal carcinoma	Esophageal Carcinoma	BEFREE	19361279, 20075075		★★★★★ ★☆☆☆☆ Found in Text Mining only
Esophageal Neoplasms	Esophageal neoplasm	Pubtator	16357509	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Esophageal Neoplasms	Esophagus Neoplasm	BEFREE	19361279, 20075075		★★★★★ ★☆☆☆☆ Found in Text Mining only
Esophageal Neoplasms	Esophageal neoplasm	Pubtator	20075075	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Esophageal Squamous Cell Carcinoma	Esophageal squamous cell carcinoma	Pubtator	25400747, 25851906, 26934576, 28694421, 30207835	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Familial lichen amyloidosis	Lichen amyloidosis	BEFREE	23089465		★★★★★ ★☆☆☆☆ Found in Text Mining only
Familial multiple trichoepitheliomata	Multiple Trichoepithelioma	BEFREE	28751461		★★★★★ ★☆☆☆☆ Found in Text Mining only
Fatty Liver	Fatty liver	Pubtator	27789406, 27789412, 34114341	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Fatty Liver Alcoholic	Fatty liver, alcoholic	Pubtator	29425759	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Fibroid Tumor	Leiomyoma	BEFREE	31176573		★★★★★ ★☆☆☆☆ Found in Text Mining only
Fibrosis, Liver	Liver Fibrosis	BEFREE	28091538		★★★★★ ★☆☆☆☆ Found in Text Mining only
Fleck corneal dystrophy	Fleck Corneal Dystrophy	BEFREE	31816405		★★★★★ ★☆☆☆☆ Found in Text Mining only
Focal glomerulosclerosis	Glomerulosclerosis	BEFREE	29925693		★★★★★ ★☆☆☆☆ Found in Text Mining only
Gastric Adenocarcinoma	Gastric Cancer	BEFREE	17614846, 24105022, 24763828		★★★★★ ★☆☆☆☆ Found in Text Mining only
Gastrointestinal Neoplasms	Gastrointestinal neoplasm	Pubtator	32084531	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Gastrointestinal Stromal Tumors	Gastrointestinal stromal tumor	BEFREE	29486292		★★★★★ ★☆☆☆☆ Found in Text Mining only
Giant Cell Arteritis	Giant cell arteritis	Pubtator	34204585	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Glaucoma 3 Primary Congenital A	Glaucoma	Pubtator	29453128	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	BEFREE	24037901, 26227255, 26821357, 27600094, 28553926, 29479058, 29507094, 30058478, 30926789		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	Pubtator	28553926, 29507094, 30058478, 33762574	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma Multiforme	Glioblastoma	BEFREE	26227255, 28553926, 29479058, 29507094, 30058478, 30926789		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	BEFREE	24318462, 24645841, 26227255, 27835585, 30658712, 31378903		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	Pubtator	37243389	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Glycogen Storage Disease Type IV	Glycogen storage disease	Pubtator	27802195	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hallopeau-Siemens Disease	DYSTROPHIC EPIDERMOLYSIS BULLOSA	BEFREE	30816994		★★★★★ ★☆☆☆☆ Found in Text Mining only
Head and Neck Neoplasms	Head and neck neoplasm	Pubtator	32019273	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hematologic Neoplasms	Hematologic Neoplasms	BEFREE	25644173, 26356851		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hepatitis Alcoholic	Alcoholic hepatitis	Pubtator	29425759	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hepatitis B	Hepatitis b	Pubtator	27909734	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hereditary Breast and Ovarian Cancer Syndrome	Hereditary breast and ovarian cancer syndrome	Pubtator	22389506, 26420673, 27323810	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hirschsprung Disease	Hirschsprung Disease	BEFREE	29383490		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hirschsprung Disease	Hirschsprung disease	Pubtator	36214716	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hodgkin Disease	Hodgkin disease	Pubtator	20519630	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Huntington Disease	Huntington Disease	BEFREE	20936902		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hyperglycemia	Hyperglycemia	BEFREE	29574754		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hyperhomocysteinemia	Hyperhomocysteinemia	BEFREE	31028566		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hyperoxia	Hyperoxia	Pubtator	35950640	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hyperplasia	Hyperplasia	Pubtator	30221668	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypertensive disease	Hypertension	BEFREE	24156273		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypoxia	Hypoxia	Pubtator	21712410, 36791645, 37768037	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypoxia	Hypoxia	Pubtator	33762574	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Idiopathic pulmonary arterial hypertension	Pulmonary arterial hypertension	BEFREE	24156273, 28478450, 30660098		★★★★★ ★☆☆☆☆ Found in Text Mining only
Idiopathic Pulmonary Fibrosis	Pulmonary Fibrosis	BEFREE	29158503		★★★★★ ★☆☆☆☆ Found in Text Mining only
Immune System Diseases	Immune System Diseases	BEFREE	24184689		★★★★★ ★☆☆☆☆ Found in Text Mining only
Intervertebral Disc Degeneration	Intervertebral disc disease	Pubtator	35266272	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Intestinal Diseases	Intestinal disease	Pubtator	33200654	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Intestinal Neoplasms	Intestinal Neoplasms	BEFREE	19074836, 20385121		★★★★★ ★☆☆☆☆ Found in Text Mining only
Juvenile arthritis	Arthritis	CTD_human_DG	19565504		★★★★★ ★☆☆☆☆ Found in Text Mining only
Juvenile psoriatic arthritis	Juvenile arthritis	CTD_human_DG	19565504		★★★★★ ★☆☆☆☆ Found in Text Mining only
Juvenile-Onset Still Disease	Still Disease	CTD_human_DG	19565504		★★★★★ ★☆☆☆☆ Found in Text Mining only
Keratoconjunctivitis Sicca	Keratoconjunctivitis Sicca	BEFREE	23921950		★★★★★ ★☆☆☆☆ Found in Text Mining only
Kidney Diseases	Kidney Disease	BEFREE	31495395, 31800161		★★★★★ ★☆☆☆☆ Found in Text Mining only
Kidney Failure	Kidney Failure	BEFREE	29925693		★★★★★ ★☆☆☆☆ Found in Text Mining only
Kidney Failure, Acute	Kidney Failure	BEFREE	27294581		★★★★★ ★☆☆☆☆ Found in Text Mining only
Kidney Neoplasms	Kidney neoplasm	Pubtator	37047552	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
leiomyosarcoma	Leiomyosarcoma	BEFREE	31176573		★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia	Leukemia	Pubtator	20401760, 33219287	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
leukemia	Leukemia	BEFREE	22592916, 27872496, 31515251		★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia	Leukemia	Pubtator	30792202	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia Myeloid	Myeloid leukemia	Pubtator	26644403	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia Myeloid Acute	Myeloid leukemia	Pubtator	26644403	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia Myeloid Acute	Myeloid leukemia	Pubtator	28359056, 32811810, 33219287, 37143070	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia Promyelocytic Acute	Promyelocytic leukemia	Pubtator	35450883	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia, Myelocytic, Acute	Leukemia	BEFREE	22592916, 23202735, 25341045, 26408402, 26644403, 27669739		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lip and Oral Cavity Carcinoma	Lip and Oral Cavity Carcinoma	BEFREE	26097551, 26517087, 30842151		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	22677193, 22937066, 26238073, 26338995, 27302923, 27725724, 27925189, 28028181, 28192402, 28239300, 28978114, 29254483, 29375271, 29425759, 29782854 View all (6 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver Diseases	Liver disease	Pubtator	34114341	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lung Diseases	Lung disease	Pubtator	35852857	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung Neoplasms	BEFREE	19737957, 26113043		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung neoplasms	Pubtator	20215880	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung neoplasms	Pubtator	24978920, 27296948, 34440860	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus, Systemic	Lupus Erythematosus	BEFREE	28097234		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic metastasis	Pubtator	25400747	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic metastasis	Pubtator	26097551, 28218782	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic Metastasis	BEFREE	28565864		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphedema distichiasis syndrome	Lymphedema-Distichiasis Syndrome	BEFREE	27346194		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphoma	Lymphoma	BEFREE	20519630		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphoma	Lymphoma	Pubtator	20519630, 25612624, 34751409	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphoma Follicular	Lymphoma	Pubtator	22102710, 28324774	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphoma, Follicular	Lymphoma	BEFREE	28324774		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphoma, Non-Hodgkin	Non-Hodgkin lymphoma	BEFREE	30020823		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malabsorption Syndromes	Malabsorption syndrome	Pubtator	37375564	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant lymphoma, lymphocytic, intermediate differentiation, diffuse	Malignant lymphoma, lymphocytic, intermediate differentiation	BEFREE	28278702		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Meningioma	Malignant Meningioma	BEFREE	28651379		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	11103818, 19503094, 21242971, 21586797, 21750654, 22751119, 23384942, 23926105, 24931170, 25127259, 25789974, 25879941, 26420673, 26729194, 27300169 View all (12 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of endometrium	Endometrial Cancer	BEFREE	30221668		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of esophagus	Esophagus Neoplasm	BEFREE	19361279, 20075075		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of gastrointestinal tract	Malignant gastrointestinal tract tumors	BEFREE	16219632, 24168184		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of kidney	Kidney Cancer	BEFREE	23722653		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of lung	Lung Cancer	BEFREE	19737957, 20215880, 23440423, 26113043, 27153563, 27296948, 28631556, 28942831, 29789534, 30606669, 31119790, 31748695		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of mouth	Malignant neoplasm of mouth	BEFREE	26517087, 30842151		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of ovary	Ovarian cancer	BEFREE	25137052, 31514068		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of pancreas	Pancreatic cancer	BEFREE	18559508, 20727893, 24947925, 28659310, 29587259		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	BEFREE	21159640, 22203039, 23089465, 24993134, 27659015, 29017567, 29269867, 29324844, 29358129, 29511594, 30176890, 30540935, 30747213, 31104329		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of skin	Skin cancer	BEFREE	19197145, 21132436, 22491752		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of stomach	Stomach Neoplasms	BEFREE	15805274, 17614846, 19327128, 22407433, 24105022, 25292057, 26191201, 27871067, 28356964, 28445396, 29221147, 29367428, 29748877, 29849786, 31146975, 31162747 View all (1 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of urinary bladder	Urinary bladder cancer	BEFREE	12901861, 24573354, 25109409, 26729194, 28380435		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	16372018, 18264726, 19268426, 19276356, 19505997, 20215880, 21159640, 21224073, 21242971, 22378186, 22407433, 22826352, 23173124, 23722653, 23926105 View all (45 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant tumor of cervix	Cervical Tumor	BEFREE	22170594, 24551169, 28639905		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant tumor of colon	Colonic Neoplasms	BEFREE	11521200, 12776194, 15051827, 16077033, 18977346, 20699379, 21531817, 22170051, 22284679, 23418515, 29498307, 29794245, 30716337		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	BEFREE	11103818, 19717984, 21242971, 26420673		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mantle cell lymphoma	Mantle Cell Lymphoma	BEFREE	28278702		★★★★★ ★☆☆☆☆ Found in Text Mining only
Marfan Syndrome	Marfan Syndrome	BEFREE	27893734		★★★★★ ★☆☆☆☆ Found in Text Mining only
Medulloblastoma	Medulloblastoma	BEFREE	20072650		★★★★★ ★☆☆☆☆ Found in Text Mining only
melanoma	Melanoma	BEFREE	28068326, 28412746, 30055641		★★★★★ ★☆☆☆☆ Found in Text Mining only
Melanoma	Melanoma	Pubtator	28412746	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Meningioma	Meningioma	Pubtator	25993161, 27102344, 27548314, 33068421, 33772057	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Meningioma	Meningioma	BEFREE	26227255, 27624470, 28651379, 29852774, 30379704, 31177425, 31653806		★★★★★ ★☆☆☆☆ Found in Text Mining only
Meningioma	Meningioma	CGI_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Metastatic Prostate Carcinoma	Metastatic Prostate Carcinoma	BEFREE	21159640		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mouth Neoplasms	Mouth neoplasm	Pubtator	26097551, 34092609	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Mouth Neoplasms	Mouth neoplasm	Pubtator	26847634	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Mucopolysaccharidosis VI	Mucopolysaccharidosis	Pubtator	38006675	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Multiple Endocrine Neoplasia Type 1	Multiple Endocrine Neoplasia	BEFREE	28395808		★★★★★ ★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Multiple myeloma	Pubtator	23585530	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Multiple myeloma	BEFREE	26109433		★★★★★ ★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Multiple myeloma	Pubtator	26109433, 33757979, 35669651, 36752202	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Multiple Sclerosis	Multiple sclerosis	Pubtator	23585530	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Multiple Sclerosis, Relapsing-Remitting	Multiple Sclerosis	BEFREE	22265745		★★★★★ ★☆☆☆☆ Found in Text Mining only
Myeloid Leukemia	Myeloid Leukemia	BEFREE	25341045, 26644403		★★★★★ ★☆☆☆☆ Found in Text Mining only
Myeloid Leukemia, Chronic	Myeloid Leukemia	BEFREE	31515251		★★★★★ ★☆☆☆☆ Found in Text Mining only
Myocardial Infarction	Myocardial Infarction	BEFREE	25860962, 28977827, 29848383		★★★★★ ★☆☆☆☆ Found in Text Mining only
Myocardial Ischemia	Myocardial Ischemia	CTD_human_DG	16214533		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Myositis Ossificans	Myositis	Pubtator	37307755	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
MYOTONIC DYSTROPHY 1	Myotonic dystrophy	BEFREE	29274549		★★★★★ ★☆☆☆☆ Found in Text Mining only
Nasopharyngeal carcinoma	Nasopharyngeal Carcinoma	BEFREE	23758499, 28179525, 28959019, 29212199, 29973197, 30108202, 31281496, 31427673		★★★★★ ★☆☆☆☆ Found in Text Mining only
Nasopharyngeal Carcinoma	Nasopharyngeal carcinoma	Pubtator	29973197	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Necrosis	Necrosis	Pubtator	36530027	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	11521200, 12776194, 14724568, 15805274, 16219632, 16372018, 16507986, 17085651, 18559508, 18977346, 19268426, 19276356, 19503094, 19737957, 20072650 View all (98 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Nephroblastoma	Nephroblastoma	BEFREE	31306741		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	Pubtator	19458492, 19495417, 23317647	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	BEFREE	23045286, 23317647, 23370975		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neurodegenerative Diseases	Neurodegenerative disorder	Pubtator	29849909	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Neurodegenerative Disorders	Neurodegenerative Disorders	BEFREE	22685291		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neurofibromatosis 2	Neurofibromatosis	Pubtator	23348505	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Nijmegen Breakage Syndrome	Nijmegen Breakage Syndrome	BEFREE	30616142		★★★★★ ★☆☆☆☆ Found in Text Mining only
Non-Small Cell Lung Carcinoma	Lung carcinoma	BEFREE	28456659, 28460458, 28631556, 29568911, 29624806, 29665649, 30221715, 30250547, 30577808, 31341030		★★★★★ ★☆☆☆☆ Found in Text Mining only
Nonalcoholic Steatohepatitis	Non-alcoholic Fatty Liver Disease	BEFREE	28683306		★★★★★ ★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	BEFREE	21670502, 27199507		★★★★★ ★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	Pubtator	27199507, 34214899	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Oropharyngeal Neoplasms	Oropharyngeal neoplasm	Pubtator	18376139	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteoarthritis	Osteoarthritis	Pubtator	30081074, 32144293	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteosarcoma	Osteosarcoma	Pubtator	26676883, 33008481, 34696664, 36539799	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteosarcoma	Osteosarcoma	BEFREE	27764757, 28552603, 29200954, 29930276		★★★★★ ★☆☆☆☆ Found in Text Mining only
ovarian neoplasm	Ovarian neoplasm	BEFREE	25137052, 31514068		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Ovarian neoplasm	Pubtator	25137052, 25169491, 31514068, 32362568	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatic carcinoma	Pancreatic carcinoma	BEFREE	18559508, 20727893, 24947925, 28659310, 29587259		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatic Ductal Adenocarcinoma	Pancreatic adenocarcinoma	BEFREE	20727893, 21412023, 26880805, 26977883, 28849150		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasm	Pancreatic Neoplasm	BEFREE	24947925		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasms	Pancreatic neoplasm	Pubtator	21224073, 27802195, 34675409, 40303408	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatitis	Pancreatitis	Pubtator	21224073	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Papillary thyroid carcinoma	Papillary thyroid carcinoma	BEFREE	31602225		★★★★★ ★☆☆☆☆ Found in Text Mining only
Parkinson Disease	Parkinson disease	BEFREE	22673189, 23370975		★★★★★ ★☆☆☆☆ Found in Text Mining only
Parkinson Disease	Parkinson disease	Pubtator	38615589	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Patent ductus arteriosus	Patent ductus arteriosus	BEFREE	26977883		★★★★★ ★☆☆☆☆ Found in Text Mining only
Polyarthritis, Juvenile, Rheumatoid Factor Negative	Seronegative polyarthritis	CTD_human_DG	19565504		★★★★★ ★☆☆☆☆ Found in Text Mining only
Polyarthritis, Juvenile, Rheumatoid Factor Positive	Polyarthritis, Rheumatoid Factor Positive	CTD_human_DG	19565504		★★★★★ ★☆☆☆☆ Found in Text Mining only
Polycythemia Vera	Polycythemia Vera	BEFREE	20601445		★★★★★ ★☆☆☆☆ Found in Text Mining only
Polycythemia Vera	Polycythemia vera	Pubtator	20601445	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Precursor B-cell lymphoblastic leukemia	Lymphoblastic Leukemia	BEFREE	22592916		★★★★★ ★☆☆☆☆ Found in Text Mining only
Precursor B-Cell Lymphoblastic Leukemia-Lymphoma	Lymphoblastic Leukemia	BEFREE	22592916		★★★★★ ★☆☆☆☆ Found in Text Mining only
Precursor T-Cell Lymphoblastic Leukemia-Lymphoma	Lymphoblastic Leukemia	BEFREE	22592916, 25037230, 25644173, 27872496, 28479419, 30790473		★★★★★ ★☆☆☆☆ Found in Text Mining only
Primary biliary cirrhosis	Biliary Cirrhosis	BEFREE	31549733		★★★★★ ★☆☆☆☆ Found in Text Mining only
Progeria	Progeria	BEFREE	28314379		★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostate carcinoma	Prostate cancer	BEFREE	21159640, 22203039, 23089465, 24993134, 27659015, 29017567, 29269867, 29324844, 29358129, 29511594, 30176890, 30540935, 30747213, 31104329		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Prostatic Intraepithelial Neoplasias	Prostatic Neoplasms	BEFREE	30540935		★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	18314491, 29017567, 30176890, 31746380, 33279858, 35512605	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	18376139, 21159640	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic Neoplasms	BEFREE	31239516		★★★★★ ★☆☆☆☆ Found in Text Mining only
Psoriasis	Psoriasis	Pubtator	31996098	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Pulmonary arterial hypertension	Pulmonary arterial hypertension	BEFREE	24156273, 30660098		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pulmonary Disease Chronic Obstructive	Chronic obstructive pulmonary disease	Pubtator	34145303	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Pulmonary Fibrosis	Pulmonary Fibrosis	BEFREE	28091538, 29158503, 31838455		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pulmonary Fibrosis	Pulmonary fibrosis	Pubtator	35852857	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Renal carcinoma	Renal Carcinoma	BEFREE	23722653		★★★★★ ★☆☆☆☆ Found in Text Mining only
Renal Cell Carcinoma	Renal Carcinoma	BEFREE	23722653		★★★★★ ★☆☆☆☆ Found in Text Mining only
Renal fibrosis	Renal fibrosis	BEFREE	25892014		★★★★★ ★☆☆☆☆ Found in Text Mining only
Renal glomerular disease	Renal Glomerular Disease	BEFREE	24812666, 31432191		★★★★★ ★☆☆☆☆ Found in Text Mining only
Respiration Disorders	Respiration Disorders	BEFREE	31172816		★★★★★ ★☆☆☆☆ Found in Text Mining only
Respiratory Tract Diseases	Respiratory system infectious disease	Pubtator	31172816	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Retinitis Pigmentosa	Retinitis pigmentosa	Pubtator	23197854, 28677533	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Rett Syndrome	Rett syndrome	Pubtator	21807996	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Rheumatoid Arthritis	Rheumatoid arthritis	BEFREE	27413250, 29997611		★★★★★ ★☆☆☆☆ Found in Text Mining only
Rhinitis Allergic	Rhinitis	Pubtator	37206297	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Right Ventricular Hypertrophy	Ventricular hypertrophy	BEFREE	24156273		★★★★★ ★☆☆☆☆ Found in Text Mining only
Sarcoma	Sarcoma	BEFREE	25756955		★★★★★ ★☆☆☆☆ Found in Text Mining only
Schizophrenia	Schizophrenia	BEFREE	27992436		★★★★★ ★☆☆☆☆ Found in Text Mining only
Scleroderma	Scleroderma	BEFREE	28365359		★★★★★ ★☆☆☆☆ Found in Text Mining only
Secretory meningioma	Secretory Meningioma	BEFREE	23404370, 26227255, 28651379		★★★★★ ★☆☆☆☆ Found in Text Mining only
Seminoma	Seminoma	BEFREE	19505997, 31572301		★★★★★ ★☆☆☆☆ Found in Text Mining only
Sepsis	Sepsis	Pubtator	33200654	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Septicemia	Septicemia	BEFREE	29975947		★★★★★ ★☆☆☆☆ Found in Text Mining only
Severe Combined Immunodeficiency	Severe combined immunodeficiency disease	BEFREE	21242971		★★★★★ ★☆☆☆☆ Found in Text Mining only
Skin Neoplasms	Skin Neoplasms	BEFREE	21132436		★★★★★ ★☆☆☆☆ Found in Text Mining only
Small Cell Lung Carcinoma	Small cell lung carcinoma	Pubtator	32176034	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
SMITH-MCCORT DYSPLASIA 1	Smith-McCort Dysplasia	BEFREE	24077167, 25985364, 29269260		★★★★★ ★☆☆☆☆ Found in Text Mining only
Spastic Paraplegia	Spastic Paraplegia	BEFREE	28324774		★★★★★ ★☆☆☆☆ Found in Text Mining only
Spastic paraplegia 20 autosomal recessive	Spastic paraplegia	Pubtator	34751409	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Spinal Muscular Atrophy	Spinal Muscular Atrophy	BEFREE	22673189		★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma	Carcinoma	BEFREE	16357510, 20972454, 26517087, 29580988		★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of esophagus	Esophagus Neoplasm	BEFREE	25851906, 26934576, 28694421, 29062163, 31686859		★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous Cell Carcinoma of Head and Neck	Squamous cell carcinoma	Pubtator	32432743, 33802627, 35219646, 38096163	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous Cell Carcinoma of Head and Neck	Squamous cell carcinoma	Pubtator	35363406	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of mouth	Oral cavity carcinoma	BEFREE	11103818		★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of skin	Skin carcinoma	BEFREE	22491752, 31284949		★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of the head and neck	Carcinoma Of The Head And Neck	BEFREE	19779097, 21219537, 31477832		★★★★★ ★☆☆☆☆ Found in Text Mining only
Steatohepatitis	Fatty Liver	BEFREE	31687083		★★★★★ ★☆☆☆☆ Found in Text Mining only
Stickler syndrome, type 1	Stickler syndrome	BEFREE	26839262		★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Carcinoma	Stomach Carcinoma	BEFREE	15805274, 17614846, 19327128, 22407433, 25292057, 26191201, 27871067, 28356964, 28445396, 29221147, 29367428, 29748877, 29849786, 31146975, 31162747		★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach Neoplasms	LHGDN	15805274		★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	21075859, 24065485, 24763828, 26191201, 35670736, 35874675, 39293524	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach Neoplasms	BEFREE	22155367		★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	23884787, 32017451	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Subarachnoid Hemorrhage	Subarachnoid hemorrhage	BEFREE	28893694		★★★★★ ★☆☆☆☆ Found in Text Mining only
Systemic Scleroderma	Scleroderma	BEFREE	28365359		★★★★★ ★☆☆☆☆ Found in Text Mining only
Teratoma	Teratoma	BEFREE	23050522, 29105400, 29761584, 31353083		★★★★★ ★☆☆☆☆ Found in Text Mining only
Thrombosis	Thrombosis	Pubtator	40362576	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Thrombotic Microangiopathies	Thrombotic Microangiopathies	BEFREE	23635876		★★★★★ ★☆☆☆☆ Found in Text Mining only
Thyroid Carcinoma Anaplastic	Thyroid cancer	Pubtator	23301671	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Thyroid Neoplasm	Thyroid Neoplasm	BEFREE	31602225		★★★★★ ★☆☆☆☆ Found in Text Mining only
Triple Negative Breast Neoplasms	Triple negative breast cancer	Pubtator	25202123, 32552913, 33918002, 37762678	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Triple Negative Breast Neoplasms	Triple Negative Breast Neoplasms	BEFREE	27300169		★★★★★ ★☆☆☆☆ Found in Text Mining only
Triple Negative Breast Neoplasms	Triple negative breast cancer	Pubtator	39938698	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Tuberous Sclerosis	Tuberous Sclerosis	BEFREE	30240435		★★★★★ ★☆☆☆☆ Found in Text Mining only
Urinary Bladder Neoplasms	Urinary bladder neoplasms	Pubtator	26729194, 27456363, 28380435, 28720065, 32126149, 38129585	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Uterine Cervical Neoplasms	Uterine neoplasm	Pubtator	22170594, 24551169	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Uterine Cervical Neoplasms	Uterine neoplasm	Pubtator	25119587, 28639905, 38537385	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Uterine Diseases	Uterine polyp	Pubtator	30221668	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Uterine Fibroids	Uterine Fibroids	BEFREE	31176573		★★★★★ ★☆☆☆☆ Found in Text Mining only
Uveitis	Uveitis	BEFREE	26746987		★★★★★ ★☆☆☆☆ Found in Text Mining only
Vascular Diseases	Vascular Diseases	BEFREE	20551324, 31597449		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ventricular arrhythmia	Ventricular arrhythmia	BEFREE	27899394		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ventricular Remodeling	Ventricular remodeling	Pubtator	34562312	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only

KLF4 (KLF transcription factor 4)