Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Associated diseases
Entrez ID	93082
Gene name	Neuralized E3 ubiquitin protein ligase 3
Gene symbol	NEURL3
Synonyms (NCBI Gene)	LINCRRNF132
Chromosome	2
Chromosome location	2q11.2

Show/Hide all (1)

miRTarBase ID	miRNA	Experiments	Reference
MIRT018320	hsa-miR-335-5p	Microarray	18185580

Show/Hide all (17)

GO ID	Ontology	Definition	Evidence	Reference
GO:0002376	Process	Immune system process	IEA
GO:0005737	Component	Cytoplasm	IDA	30111563
GO:0005737	Component	Cytoplasm	IEA
GO:0005769	Component	Early endosome	IBA
GO:0008270	Function	Zinc ion binding	IEA
GO:0016567	Process	Protein ubiquitination	IEA
GO:0016567	Process	Protein ubiquitination	IEA
GO:0016740	Function	Transferase activity	IEA
GO:0043409	Process	Negative regulation of MAPK cascade	ISS
GO:0045087	Process	Innate immune response	IEA
GO:0046872	Function	Metal ion binding	IEA
GO:0061630	Function	Ubiquitin protein ligase activity	IBA
GO:0061630	Function	Ubiquitin protein ligase activity	IDA	38667302
GO:0061630	Function	Ubiquitin protein ligase activity	IEA
GO:0070086	Process	Ubiquitin-dependent endocytosis	IBA
GO:0070371	Process	ERK1 and ERK2 cascade	IDA	16314496
GO:1901800	Process	Positive regulation of proteasomal protein catabolic process	IDA	38667302

MIM	HGNC	e!Ensembl
617206	25162	ENSG00000163121

Q96EH8

Protein name

E3 ubiquitin-protein ligase NEURL3 (EC 2.3.2.27) (Lung-inducible neuralized-related C3CH4 RING domain protein) (Neuralized-like protein 3) (RING-type E3 ubiquitin transferase NEURL3)

Protein function

E3 ubiquitin-protein ligase that plays a role in various biological processes such as lung development or innate immunity (PubMed:30111563). Seems to utilize UBE2E1. Promotes innate antiviral response by catalyzing 'Lys-63'-linked ubiquitination

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF07177	Neuralized	20 → 172	Neuralized	Domain
PF13920	zf-C3HC4_3	199 → 247		Domain

Sequence

MGAQLCFEANAKAPREALRFHAEAKGAQVRLDTRGCIAHRRTTFHDGIVFSQRPVRLGER
VALRVLREESGWCGGLRVGFTRLDPACVSVPSLPPFLCPDLEEQSPTWAAVLPEGCALTG
DLVRFWVDRRGCLFAKVNAGCRLLLREGVPVGAPLWAVMDVYGTTKAIELLDPTASRLPT
PMPWDLSNKAVPEPKATPGEECAICFYHAANTRLVPCGHTYFCRYCAWRVFSDTAKCPVC
RWQIEAVAPAQGPPALRVEEGS

Sequence length

262

Interactions

View interactions

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (1)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
INSOMNIA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (5)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Hepatitis C	Hepatitis c	Pubtator	30111563	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia, Myelocytic, Acute	Leukemia	GWASCAT_DG	27903959		★★★★★ ★☆☆☆☆ Found in Text Mining only
Multiple Sclerosis	Multiple Sclerosis	BEFREE	31790618		★★★★★ ★☆☆☆☆ Found in Text Mining only
Nasopharyngeal Carcinoma	Nasopharyngeal carcinoma	Pubtator	38191501	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasms	Pancreatic neoplasm	Pubtator	39674387	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only

NEURL3 (neuralized E3 ubiquitin protein ligase 3)