CD83 (CD83 molecule)

Gene

• Entrez ID: 9308
• Gene name: CD83 molecule
• Gene symbol: CD83
• Synonyms (NCBI Gene): BL11, HB15
• Chromosome: 6
• Chromosome location: 6p23
• Summary: The protein encoded by this gene is a single-pass type I membrane protein and member of the immunoglobulin superfamily of receptors. The encoded protein may be involved in the regulation of antigen presentation. A soluble form of this protein can bind to

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT002516	hsa-miR-373-3p	Microarray	15685193
MIRT002516	hsa-miR-373-3p	Microarray;Other	15685193
MIRT021231	hsa-miR-146a-5p	Other	20375304
MIRT023390	hsa-miR-122-5p	Microarray	17612493
MIRT024870	hsa-miR-215-5p	Microarray	19074876
MIRT026759	hsa-miR-192-5p	Microarray	19074876
MIRT876291	hsa-miR-1324	CLIP-seq
MIRT876292	hsa-miR-137	CLIP-seq
MIRT876293	hsa-miR-1825	CLIP-seq
MIRT876294	hsa-miR-194	CLIP-seq
MIRT876295	hsa-miR-198	CLIP-seq
MIRT876296	hsa-miR-199a-5p	CLIP-seq
MIRT876297	hsa-miR-199b-5p	CLIP-seq
MIRT876298	hsa-miR-22	CLIP-seq
MIRT876299	hsa-miR-3136-5p	CLIP-seq
MIRT876300	hsa-miR-3925-3p	CLIP-seq
MIRT876301	hsa-miR-3977	CLIP-seq
MIRT876302	hsa-miR-4279	CLIP-seq
MIRT876303	hsa-miR-4439	CLIP-seq
MIRT876304	hsa-miR-4459	CLIP-seq
MIRT876305	hsa-miR-4513	CLIP-seq
MIRT876306	hsa-miR-4659a-3p	CLIP-seq
MIRT876307	hsa-miR-4659b-3p	CLIP-seq
MIRT876308	hsa-miR-4691-5p	CLIP-seq
MIRT876309	hsa-miR-4768-5p	CLIP-seq
MIRT876310	hsa-miR-4778-3p	CLIP-seq
MIRT876311	hsa-miR-563	CLIP-seq
MIRT876312	hsa-miR-665	CLIP-seq
MIRT876313	hsa-miR-942	CLIP-seq
MIRT876314	hsa-miR-4700-3p	CLIP-seq
MIRT876315	hsa-miR-548v	CLIP-seq
MIRT876306	hsa-miR-4659a-3p	CLIP-seq
MIRT876307	hsa-miR-4659b-3p	CLIP-seq
MIRT1959689	hsa-miR-302a	CLIP-seq
MIRT1959690	hsa-miR-302b	CLIP-seq
MIRT1959691	hsa-miR-302c	CLIP-seq
MIRT1959692	hsa-miR-302d	CLIP-seq
MIRT1959693	hsa-miR-302e	CLIP-seq
MIRT1959694	hsa-miR-3665	CLIP-seq
MIRT1959695	hsa-miR-372	CLIP-seq
MIRT1959696	hsa-miR-373	CLIP-seq
MIRT1959697	hsa-miR-376c	CLIP-seq
MIRT1959698	hsa-miR-4464	CLIP-seq
MIRT1959699	hsa-miR-4748	CLIP-seq
MIRT1959700	hsa-miR-519a	CLIP-seq
MIRT1959701	hsa-miR-519b-3p	CLIP-seq
MIRT1959702	hsa-miR-519c-3p	CLIP-seq
MIRT1959703	hsa-miR-520a-3p	CLIP-seq
MIRT1959704	hsa-miR-520b	CLIP-seq
MIRT1959705	hsa-miR-520c-3p	CLIP-seq
MIRT1959706	hsa-miR-520d-3p	CLIP-seq
MIRT1959707	hsa-miR-520e	CLIP-seq
MIRT1959708	hsa-miR-657	CLIP-seq
MIRT2196703	hsa-miR-1207-3p	CLIP-seq
MIRT2196704	hsa-miR-15a	CLIP-seq
MIRT2196705	hsa-miR-15b	CLIP-seq
MIRT2196706	hsa-miR-16	CLIP-seq
MIRT2196707	hsa-miR-195	CLIP-seq
MIRT876295	hsa-miR-198	CLIP-seq
MIRT1959689	hsa-miR-302a	CLIP-seq
MIRT1959690	hsa-miR-302b	CLIP-seq
MIRT1959691	hsa-miR-302c	CLIP-seq
MIRT1959692	hsa-miR-302d	CLIP-seq
MIRT1959693	hsa-miR-302e	CLIP-seq
MIRT1959694	hsa-miR-3665	CLIP-seq
MIRT2196708	hsa-miR-3677-5p	CLIP-seq
MIRT1959695	hsa-miR-372	CLIP-seq
MIRT1959696	hsa-miR-373	CLIP-seq
MIRT1959697	hsa-miR-376c	CLIP-seq
MIRT2196709	hsa-miR-424	CLIP-seq
MIRT2196710	hsa-miR-4434	CLIP-seq
MIRT876304	hsa-miR-4459	CLIP-seq
MIRT1959698	hsa-miR-4464	CLIP-seq
MIRT2196711	hsa-miR-4488	CLIP-seq
MIRT2196712	hsa-miR-4516	CLIP-seq
MIRT2196713	hsa-miR-4519	CLIP-seq
MIRT2196714	hsa-miR-4531	CLIP-seq
MIRT2196715	hsa-miR-4640-5p	CLIP-seq
MIRT2196716	hsa-miR-4672	CLIP-seq
MIRT2196717	hsa-miR-4697-5p	CLIP-seq
MIRT2196718	hsa-miR-4726-5p	CLIP-seq
MIRT2196719	hsa-miR-4731-5p	CLIP-seq
MIRT1959699	hsa-miR-4748	CLIP-seq
MIRT2196720	hsa-miR-497	CLIP-seq
MIRT1959700	hsa-miR-519a	CLIP-seq
MIRT1959701	hsa-miR-519b-3p	CLIP-seq
MIRT1959702	hsa-miR-519c-3p	CLIP-seq
MIRT1959703	hsa-miR-520a-3p	CLIP-seq
MIRT1959704	hsa-miR-520b	CLIP-seq
MIRT1959705	hsa-miR-520c-3p	CLIP-seq
MIRT1959706	hsa-miR-520d-3p	CLIP-seq
MIRT1959707	hsa-miR-520e	CLIP-seq
MIRT876311	hsa-miR-563	CLIP-seq
MIRT2196721	hsa-miR-637	CLIP-seq
MIRT1959708	hsa-miR-657	CLIP-seq
MIRT876312	hsa-miR-665	CLIP-seq
MIRT2465072	hsa-miR-3163	CLIP-seq
MIRT2465073	hsa-miR-3688-5p	CLIP-seq
MIRT2465074	hsa-miR-548c-3p	CLIP-seq

Transcription factors

Transcription factor	Regulation	Reference
NFKB1	Activation	19164127
NFKB1	Unknown	12182451
PPARG	Activation	15356156
RELA	Activation	19164127
SP1	Unknown	12182451
SP3	Unknown	12182451

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0002376	Process	Immune system process	IEA
GO:0005515	Function	Protein binding	IPI	20374249, 32296183
GO:0005886	Component	Plasma membrane	IEA
GO:0005886	Component	Plasma membrane	TAS	8422464, 9310491
GO:0006952	Process	Defense response	TAS	1378080
GO:0006959	Process	Humoral immune response	TAS	8422464
GO:0007165	Process	Signal transduction	TAS	9310491
GO:0009897	Component	External side of plasma membrane	IEA
GO:0016020	Component	Membrane	IEA
GO:0032713	Process	Negative regulation of interleukin-4 production	IEA
GO:0032733	Process	Positive regulation of interleukin-10 production	IEA
GO:0032743	Process	Positive regulation of interleukin-2 production	IEA
GO:0043367	Process	CD4-positive, alpha-beta T cell differentiation	IEA
GO:0043372	Process	Positive regulation of CD4-positive, alpha-beta T cell differentiation	IEA

Other IDs

• MIM: 604534
• HGNC: 1703
• e!Ensembl: ENSG00000112149

Protein

• UniProt ID: Q01151
• Protein name: CD83 antigen (hCD83) (B-cell activation protein) (Cell surface protein HB15) (CD antigen CD83)
• Protein function: Transmembrane glycoprotein predominantly found on the surface of many immune cells including dendritic cells or lymphocytes that plays various roles in immune response regulation. Plays an essential role in CD4(+) T-selection, differentiation an
• PDB: 5MIX, 5MJ0, 5MJ1, 5MJ2
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF07686	V-set	19 → 127	Immunoglobulin V-set domain	Domain

• Tissue specificity: TISSUE SPECIFICITY: Expressed by activated lymphocytes, Langerhans cells and activatd dendritic cells. {ECO:0000269|PubMed:11922761}.
• Sequence:

  MSRGLQLLLLSCAYSLAPATPEVKVACSEDVDLPCTAPWDPQVPYTVSWVKLLEGGEERM
  ETPQEDHLRGQHYHQKGQNGSFDAPNERPYSLKIRNTTSCNSGTYRCTLQDPDGQRNLSG
  KVILRVTGCPAQRKEETFKKYRAEIVLLLALVIFYLTLIIFTCKFARLQSIFPDFSKAGM
  ERAFLPVTSPNKHLGLVTPHKTELV

• Sequence length: 205

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
ARTHRITIS, JUVENILE	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ARTHRITIS, RHEUMATOID	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BREAST CARCINOMA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
COLORECTAL CANCER	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DERMATOLOGIC DISORDERS	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
JUVENILE CHRONIC POLYARTHRITIS	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LIVER CIRRHOSIS, EXPERIMENTAL	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MONOARTICULAR JUVENILE RHEUMATOID ARTHRITIS	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PAUCIARTICULAR JUVENILE RHEUMATOID ARTHRITIS	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
RHEUMATOID ARTHRITIS	—	Disgenet, GWAS catalog Disgenet, GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SKIN DISEASES	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SKIN DISEASES, GENETIC	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SYSTEMIC LUPUS ERYTHEMATOSUS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Acne	Acne	BEFREE	25153527		★☆☆☆☆ Found in Text Mining only
Acne Vulgaris	Acne	BEFREE	25153527		★☆☆☆☆ Found in Text Mining only
Acute lymphocytic leukemia	Lymphocytic Leukemia	BEFREE	21492747		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma	Adenocarcinoma	BEFREE	19446866		★☆☆☆☆ Found in Text Mining only
Adult Acute Lymphocytic Leukemia	Lymphocytic Leukemia	BEFREE	21492747		★☆☆☆☆ Found in Text Mining only
Adult Hodgkin Lymphoma	Hodgkin Lymphoma	BEFREE	29351987		★☆☆☆☆ Found in Text Mining only
Amyotrophic Lateral Sclerosis	Amyotrophic lateral sclerosis	Pubtator	20937945	Associate	★☆☆☆☆ Found in Text Mining only
Arsenic Encephalopathy	Arsenic Encephalopathy	CTD_human_DG	16835338		★☆☆☆☆ Found in Text Mining only
Arthritis	Arthritis	BEFREE	31001257		★☆☆☆☆ Found in Text Mining only
Arthritis	Arthritis	Pubtator	34691053	Associate	★☆☆☆☆ Found in Text Mining only
Arthritis Psoriatic	Psoriatic arthritis	Pubtator	16507115	Associate	★☆☆☆☆ Found in Text Mining only
Arthritis Rheumatoid	Rheumatoid arthritis	Pubtator	12417058, 18292234, 23577190, 29999150	Associate	★☆☆☆☆ Found in Text Mining only
Arthritis, Psoriatic	Psoriatic Arthritis	BEFREE	16507115		★☆☆☆☆ Found in Text Mining only
Autoimmune Diseases	Autoimmune Diseases	BEFREE	27837105, 28267648, 29643191, 31231400		★☆☆☆☆ Found in Text Mining only
Barrett Esophagus	Barrett esophagus	Pubtator	19015928	Associate	★☆☆☆☆ Found in Text Mining only
Behcet Syndrome	Behcet Syndrome	BEFREE	31582900		★☆☆☆☆ Found in Text Mining only
Behcet Syndrome	Behcet disease	Pubtator	36226612	Associate	★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	20631064		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Breast Neoplasms	Breast neoplasm	Pubtator	37684436	Associate	★☆☆☆☆ Found in Text Mining only
Bronchiolitis	Bronchiolitis	Pubtator	18256061	Associate	★☆☆☆☆ Found in Text Mining only
Bruton type agammaglobulinemia	Bruton type agammaglobulinemia	Pubtator	30147693	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Basal Cell	Basal cell carcinoma	Pubtator	2366004	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	15965645, 18793383	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Pancreatic Ductal	Pancreatic ductal carcinoma	Pubtator	20976171	Stimulate	★☆☆☆☆ Found in Text Mining only
Carcinoma Squamous Cell	Squamous cell carcinoma	Pubtator	16412062	Inhibit	★☆☆☆☆ Found in Text Mining only
Carcinoma Squamous Cell	Squamous cell carcinoma	Pubtator	22134374, 28052400	Associate	★☆☆☆☆ Found in Text Mining only
Cardiomyopathies	Cardiomyopathy	Pubtator	16584112	Associate	★☆☆☆☆ Found in Text Mining only
cervical cancer	Cervical Cancer	BEFREE	18056445, 19446866		★☆☆☆☆ Found in Text Mining only
Cervix carcinoma	Cervix carcinoma	BEFREE	18056445, 19446866		★☆☆☆☆ Found in Text Mining only
Childhood Acute Lymphoblastic Leukemia	Lymphoblastic Leukemia	BEFREE	21492747		★☆☆☆☆ Found in Text Mining only
Chronic Infantile Neurological, Cutaneous, and Articular Syndrome	Neurological, Cutaneous And Articular Syndrome	BEFREE	26245468		★☆☆☆☆ Found in Text Mining only
Chronic Lymphocytic Leukemia	Lymphocytic Leukemia	BEFREE	11342340		★☆☆☆☆ Found in Text Mining only
Chronic Lymphocytic Leukemia	Lymphocytic Leukemia	LHGDN	14687618		★☆☆☆☆ Found in Text Mining only
Chronic Obstructive Airway Disease	Chronic Obstructive Pulmonary Disease	BEFREE	15994259, 24742278		★☆☆☆☆ Found in Text Mining only
Colitis	Colitis	BEFREE	25151500		★☆☆☆☆ Found in Text Mining only
Colitis Ulcerative	Ulcerative colitis	Pubtator	12109441	Associate	★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	16101177	Associate	★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal Neoplasms	BEFREE	23998914		★☆☆☆☆ Found in Text Mining only
Common Variable Immunodeficiency	Common variable immunodeficiency	Pubtator	33190167	Associate	★☆☆☆☆ Found in Text Mining only
Coronary Artery Disease	Coronary artery disease	Pubtator	20628522	Stimulate	★☆☆☆☆ Found in Text Mining only
Crohn Disease	Crohn Disease	LHGDN	12594843		★☆☆☆☆ Found in Text Mining only
Crohn Disease	Crohn disease	Pubtator	12594843, 19095953	Associate	★☆☆☆☆ Found in Text Mining only
Dermatitis Atopic	Atopic dermatitis	Pubtator	11241286, 15370698	Associate	★☆☆☆☆ Found in Text Mining only
Dermatologic disorders	Dermatologic Disorders	CTD_human_DG	16835338		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Dermatomyositis	Dermatomyositis	LHGDN	17469160		★☆☆☆☆ Found in Text Mining only
Dermatomyositis, Childhood Type	Dermatomyositis	BEFREE	17469160		★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus Type 1	Diabetes mellitus, type 1	Pubtator	22344559	Associate	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus Type 1	Diabetes mellitus, type 1	Pubtator	34659254	Inhibit	★☆☆☆☆ Found in Text Mining only
Diffuse Large B-Cell Lymphoma	Diffuse Lymphoma	LHGDN	17535098		★☆☆☆☆ Found in Text Mining only
Endometrial Neoplasms	Endometrial neoplasm	Pubtator	39387602	Inhibit	★☆☆☆☆ Found in Text Mining only
Esophageal Neoplasms	Esophageal neoplasm	Pubtator	15052669	Associate	★☆☆☆☆ Found in Text Mining only
Esophageal Squamous Cell Carcinoma	Esophageal squamous cell carcinoma	Pubtator	36921563	Associate	★☆☆☆☆ Found in Text Mining only
Giant Cell Arteritis	Giant Cell Arteritis	BEFREE	14734523		★☆☆☆☆ Found in Text Mining only
Giant Cell Arteritis	Giant cell arteritis	Pubtator	35045965	Associate	★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	Pubtator	36766715	Associate	★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	Pubtator	36766715	Associate	★☆☆☆☆ Found in Text Mining only
Gout	Gout	Pubtator	35116032	Associate	★☆☆☆☆ Found in Text Mining only
Graft vs Host Disease	Graft-versus-host disease	Pubtator	36622700	Inhibit	★☆☆☆☆ Found in Text Mining only
Graves Disease	Graves Disease	BEFREE	16285898		★☆☆☆☆ Found in Text Mining only
Graves Disease	Graves disease	Pubtator	16285898	Stimulate	★☆☆☆☆ Found in Text Mining only
Hashimoto Disease	Hashimoto Disease	BEFREE	16285898		★☆☆☆☆ Found in Text Mining only
Hashimoto Disease	Hashimoto disease	Pubtator	16285898	Stimulate	★☆☆☆☆ Found in Text Mining only
Heart Failure	Heart failure	Pubtator	37684436	Associate	★☆☆☆☆ Found in Text Mining only
Hematologic Neoplasms	Hematologic Neoplasms	LHGDN	14687618		★☆☆☆☆ Found in Text Mining only
Hematologic Neoplasms	Hematologic Neoplasms	BEFREE	31231400		★☆☆☆☆ Found in Text Mining only
Hermansky Pudlak syndrome 2	Hermansky-pudlak syndrome	Pubtator	27207797	Associate	★☆☆☆☆ Found in Text Mining only
Histiocytosis, Langerhans-Cell	Histiocytosis	BEFREE	11241286, 27597420		★☆☆☆☆ Found in Text Mining only
Hodgkin Disease	Hodgkin disease	Pubtator	24633193	Associate	★☆☆☆☆ Found in Text Mining only
Hodgkin Disease	Hodgkin Disease	BEFREE	29351987		★☆☆☆☆ Found in Text Mining only
Huntington Disease	Huntington disease	Pubtator	30346851	Inhibit	★☆☆☆☆ Found in Text Mining only
Immune thrombocytopenic purpura	Immune Thrombocytopenic Purpura	BEFREE	30346851		★☆☆☆☆ Found in Text Mining only
Immunologic Deficiency Syndromes	Immunologic Deficiency Syndromes	BEFREE	11535497		★☆☆☆☆ Found in Text Mining only
Juvenile arthritis	Arthritis	CTD_human_DG	19565504		★☆☆☆☆ Found in Text Mining only
Juvenile psoriatic arthritis	Juvenile arthritis	CTD_human_DG	19565504		★☆☆☆☆ Found in Text Mining only
Juvenile-Onset Still Disease	Still Disease	CTD_human_DG	19565504		★☆☆☆☆ Found in Text Mining only
Laryngeal Neoplasms	Laryngeal neoplasm	Pubtator	23632869, 23690219	Associate	★☆☆☆☆ Found in Text Mining only
Leukemia	Leukemia	Pubtator	10458772	Associate	★☆☆☆☆ Found in Text Mining only
Leukemia Myeloid Acute	Myeloid leukemia	Pubtator	11823047, 15183897, 25795133, 36622700, 37596597	Associate	★☆☆☆☆ Found in Text Mining only
Leukemia Myelomonocytic Chronic	Myelomonocytic leukemia	Pubtator	10554809	Associate	★☆☆☆☆ Found in Text Mining only
Leukoplakia, Oral	Leukoplakia	BEFREE	30056280		★☆☆☆☆ Found in Text Mining only
Lip and Oral Cavity Carcinoma	Lip and Oral Cavity Carcinoma	BEFREE	28454394		★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	30062618		★☆☆☆☆ Found in Text Mining only
Liver Cirrhosis Biliary	Liver cirrhosis	Pubtator	22727562	Inhibit	★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung Neoplasms	LHGDN	17628801		★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung neoplasms	Pubtator	17628801	Associate	★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus Systemic	Systemic lupus erythematosus	Pubtator	17056512	Inhibit	★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus Systemic	Systemic lupus erythematosus	Pubtator	34084162, 39366755	Associate	★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus, Systemic	Lupus Erythematosus	LHGDN	18625638		★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic metastasis	Pubtator	16101177	Inhibit	★☆☆☆☆ Found in Text Mining only
Malignant lymphoma, lymphocytic, intermediate differentiation, diffuse	Malignant lymphoma, lymphocytic, intermediate differentiation	LHGDN	14687618		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	20631064		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of mouth	Malignant neoplasm of mouth	BEFREE	28454394		★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	31135138		★☆☆☆☆ Found in Text Mining only
Malignant tumor of cervix	Cervical Tumor	BEFREE	18056445, 19446866		★☆☆☆☆ Found in Text Mining only
Mediastinal (Thymic) Large B-Cell Lymphoma	B-Cell Lymphoma	BEFREE	31075666		★☆☆☆☆ Found in Text Mining only
melanoma	Melanoma	BEFREE	11986195, 17624244, 18221542, 28424693		★☆☆☆☆ Found in Text Mining only
Melanoma	Melanoma	Pubtator	17624244	Inhibit	★☆☆☆☆ Found in Text Mining only
Melanoma	Melanoma	Pubtator	18221542, 29538091, 35408802	Associate	★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Multiple myeloma	BEFREE	10029574		★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Multiple myeloma	Pubtator	10029574, 10989194	Associate	★☆☆☆☆ Found in Text Mining only
Multiple Sclerosis	Multiple Sclerosis	BEFREE	29759135		★☆☆☆☆ Found in Text Mining only
Myasthenia Gravis	Myasthenia Gravis	BEFREE	12707978		★☆☆☆☆ Found in Text Mining only
Myositis	Myositis	BEFREE	17469160		★☆☆☆☆ Found in Text Mining only
Nasal Polyps	Nasal polyposis	BEFREE	29904400		★☆☆☆☆ Found in Text Mining only
Necrosis	Necrosis	Pubtator	12905492, 16108813	Stimulate	★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	10562317, 15918076, 16899480, 21740748, 23998914, 29388277, 30062618		★☆☆☆☆ Found in Text Mining only
Non-Small Cell Lung Carcinoma	Lung carcinoma	BEFREE	25901080		★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Ovarian neoplasm	Pubtator	19955923	Inhibit	★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Ovarian neoplasm	Pubtator	28589429	Associate	★☆☆☆☆ Found in Text Mining only
Pleural effusion disorder	Pleural effusion	BEFREE	31677529		★☆☆☆☆ Found in Text Mining only
Polyarthritis, Juvenile, Rheumatoid Factor Negative	Seronegative polyarthritis	CTD_human_DG	19565504		★☆☆☆☆ Found in Text Mining only
Polyarthritis, Juvenile, Rheumatoid Factor Positive	Polyarthritis, Rheumatoid Factor Positive	CTD_human_DG	19565504		★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	37435060	Associate	★☆☆☆☆ Found in Text Mining only
Pulmonary Disease Chronic Obstructive	Chronic obstructive pulmonary disease	Pubtator	15994259, 19729666	Associate	★☆☆☆☆ Found in Text Mining only
Pulmonary Disease Chronic Obstructive	Chronic obstructive pulmonary disease	Pubtator	24742278, 25338516	Inhibit	★☆☆☆☆ Found in Text Mining only
Rheumatoid Arthritis	Rheumatoid arthritis	BEFREE	12571844, 28267648		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Rheumatoid Arthritis	Rheumatoid arthritis	LHGDN	18292234		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Rheumatoid Arthritis	Rheumatoid arthritis	CTD_human_DG	22446963		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Sarcoma Ewing	Sarcoma	Pubtator	34831294	Associate	★☆☆☆☆ Found in Text Mining only
Squamous Cell Carcinoma of Head and Neck	Squamous cell carcinoma	Pubtator	16827115, 35293509	Associate	★☆☆☆☆ Found in Text Mining only
Thrombosis	Thrombosis	Pubtator	36226612	Associate	★☆☆☆☆ Found in Text Mining only
Thyroid Diseases	Thyroid Diseases	BEFREE	16285898		★☆☆☆☆ Found in Text Mining only
Thyroiditis Autoimmune	Thyroiditis	Pubtator	16285898	Associate	★☆☆☆☆ Found in Text Mining only
Uterine Cervical Neoplasms	Uterine neoplasm	Pubtator	19446866	Associate	★☆☆☆☆ Found in Text Mining only
Uveitis	Uveitis	Pubtator	37137669	Associate	★☆☆☆☆ Found in Text Mining only
Vasculitis	Vasculitis	BEFREE	14734523		★☆☆☆☆ Found in Text Mining only
Vitamin D Deficiency	Vitamin d deficiency	Pubtator	23527013	Associate	★☆☆☆☆ Found in Text Mining only
X-linked agammaglobulinemia	Agammaglobulinemia, X-Linked	BEFREE	12823285		★☆☆☆☆ Found in Text Mining only