CD19 (CD19 molecule)

Gene

• Entrez ID: 930
• Gene name: CD19 molecule
• Gene symbol: CD19
• Synonyms (NCBI Gene): B4, CVID3
• Chromosome: 16
• Chromosome location: 16p11.2
• Summary: This gene encodes a member of the immunoglobulin gene superfamily. Expression of this cell surface protein is restricted to B cell lymphocytes. This protein is a reliable marker for pre-B cells but its expression diminishes during terminal B cell differen

SNPs

SNP ID	Visualize variation	Clinical significance	Consequence
rs148808609	C>A	Conflicting-interpretations-of-pathogenicity, likely-benign	Intron variant, genic downstream transcript variant
rs372929312	G>C	Likely-pathogenic, uncertain-significance	Genic downstream transcript variant, downstream transcript variant, splice donor variant
rs758555433	G>T	Likely-pathogenic	Missense variant, coding sequence variant, non coding transcript variant, intron variant
rs774006181	A>-	Uncertain-significance, likely-pathogenic	Coding sequence variant, genic downstream transcript variant, frameshift variant
rs886037920	G>C	Pathogenic	Missense variant, non coding transcript variant, intron variant, coding sequence variant
rs886037921	C>-	Pathogenic	Frameshift variant, genic downstream transcript variant, coding sequence variant
rs1064794850	G>A	Likely-pathogenic	Genic downstream transcript variant, downstream transcript variant, splice donor variant
rs1567506566	G>T	Pathogenic	Intron variant, genic downstream transcript variant, splice acceptor variant
rs1596712783	G>A	Likely-pathogenic	Stop gained, intron variant, coding sequence variant, non coding transcript variant
rs1596718225	T>G	Likely-pathogenic	Splice donor variant, downstream transcript variant, genic downstream transcript variant

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT539632	hsa-miR-8485	HITS-CLIP	23313552
MIRT539631	hsa-miR-329-3p	HITS-CLIP	23313552
MIRT539630	hsa-miR-362-3p	HITS-CLIP	23313552
MIRT539629	hsa-miR-603	HITS-CLIP	23313552
MIRT609359	hsa-miR-4643	HITS-CLIP	23313552
MIRT539628	hsa-miR-216b-3p	HITS-CLIP	23313552
MIRT539627	hsa-miR-3941	HITS-CLIP	23313552
MIRT539626	hsa-miR-4672	HITS-CLIP	23313552
MIRT539625	hsa-miR-466	HITS-CLIP	23313552
MIRT539632	hsa-miR-8485	HITS-CLIP	23824327
MIRT539631	hsa-miR-329-3p	HITS-CLIP	23824327
MIRT539630	hsa-miR-362-3p	HITS-CLIP	23824327
MIRT539629	hsa-miR-603	HITS-CLIP	23824327
MIRT539628	hsa-miR-216b-3p	HITS-CLIP	23824327
MIRT539627	hsa-miR-3941	HITS-CLIP	23824327
MIRT539626	hsa-miR-4672	HITS-CLIP	23824327
MIRT539625	hsa-miR-466	HITS-CLIP	23824327
MIRT539624	hsa-miR-4789-5p	HITS-CLIP	23824327
MIRT539632	hsa-miR-8485	HITS-CLIP	23824327
MIRT539631	hsa-miR-329-3p	HITS-CLIP	23824327
MIRT539630	hsa-miR-362-3p	HITS-CLIP	23824327
MIRT539629	hsa-miR-603	HITS-CLIP	23824327
MIRT539628	hsa-miR-216b-3p	HITS-CLIP	23824327
MIRT539627	hsa-miR-3941	HITS-CLIP	23824327
MIRT539626	hsa-miR-4672	HITS-CLIP	23824327
MIRT539625	hsa-miR-466	HITS-CLIP	23824327
MIRT539624	hsa-miR-4789-5p	HITS-CLIP	23824327
MIRT539632	hsa-miR-8485	HITS-CLIP	23824327
MIRT539631	hsa-miR-329-3p	HITS-CLIP	23824327
MIRT539630	hsa-miR-362-3p	HITS-CLIP	23824327
MIRT539629	hsa-miR-603	HITS-CLIP	23824327
MIRT609359	hsa-miR-4643	HITS-CLIP	23824327
MIRT539628	hsa-miR-216b-3p	HITS-CLIP	23824327
MIRT539627	hsa-miR-3941	HITS-CLIP	23824327
MIRT539626	hsa-miR-4672	HITS-CLIP	23824327
MIRT539625	hsa-miR-466	HITS-CLIP	23824327
MIRT539624	hsa-miR-4789-5p	HITS-CLIP	23824327
MIRT539632	hsa-miR-8485	HITS-CLIP	23824327
MIRT539631	hsa-miR-329-3p	HITS-CLIP	23824327
MIRT539630	hsa-miR-362-3p	HITS-CLIP	23824327
MIRT539629	hsa-miR-603	HITS-CLIP	23824327
MIRT539628	hsa-miR-216b-3p	HITS-CLIP	23824327
MIRT539627	hsa-miR-3941	HITS-CLIP	23824327
MIRT539626	hsa-miR-4672	HITS-CLIP	23824327
MIRT539625	hsa-miR-466	HITS-CLIP	23824327
MIRT539624	hsa-miR-4789-5p	HITS-CLIP	23824327
MIRT539632	hsa-miR-8485	HITS-CLIP	23824327
MIRT539631	hsa-miR-329-3p	HITS-CLIP	23824327
MIRT539630	hsa-miR-362-3p	HITS-CLIP	23824327
MIRT539629	hsa-miR-603	HITS-CLIP	23824327
MIRT609359	hsa-miR-4643	HITS-CLIP	23824327
MIRT539628	hsa-miR-216b-3p	HITS-CLIP	23824327
MIRT669849	hsa-miR-3622b-5p	HITS-CLIP	23824327
MIRT539627	hsa-miR-3941	HITS-CLIP	23824327
MIRT539626	hsa-miR-4672	HITS-CLIP	23824327
MIRT539625	hsa-miR-466	HITS-CLIP	23824327
MIRT539624	hsa-miR-4789-5p	HITS-CLIP	23824327
MIRT539632	hsa-miR-8485	HITS-CLIP	23824327
MIRT539631	hsa-miR-329-3p	HITS-CLIP	23824327
MIRT539630	hsa-miR-362-3p	HITS-CLIP	23824327
MIRT539629	hsa-miR-603	HITS-CLIP	23824327
MIRT609359	hsa-miR-4643	HITS-CLIP	23824327
MIRT539628	hsa-miR-216b-3p	HITS-CLIP	23824327
MIRT539627	hsa-miR-3941	HITS-CLIP	23824327
MIRT539626	hsa-miR-4672	HITS-CLIP	23824327
MIRT539625	hsa-miR-466	HITS-CLIP	23824327
MIRT539624	hsa-miR-4789-5p	HITS-CLIP	23824327
MIRT539632	hsa-miR-8485	HITS-CLIP	23824327
MIRT539631	hsa-miR-329-3p	HITS-CLIP	23824327
MIRT539630	hsa-miR-362-3p	HITS-CLIP	23824327
MIRT539629	hsa-miR-603	HITS-CLIP	23824327
MIRT539628	hsa-miR-216b-3p	HITS-CLIP	23824327
MIRT539627	hsa-miR-3941	HITS-CLIP	23824327
MIRT539626	hsa-miR-4672	HITS-CLIP	23824327
MIRT539625	hsa-miR-466	HITS-CLIP	23824327
MIRT539632	hsa-miR-8485	HITS-CLIP	23824327
MIRT539631	hsa-miR-329-3p	HITS-CLIP	23824327
MIRT539630	hsa-miR-362-3p	HITS-CLIP	23824327
MIRT539629	hsa-miR-603	HITS-CLIP	23824327
MIRT539628	hsa-miR-216b-3p	HITS-CLIP	23824327
MIRT539627	hsa-miR-3941	HITS-CLIP	23824327
MIRT539626	hsa-miR-4672	HITS-CLIP	23824327
MIRT539625	hsa-miR-466	HITS-CLIP	23824327
MIRT539624	hsa-miR-4789-5p	HITS-CLIP	23824327
MIRT539632	hsa-miR-8485	HITS-CLIP	23824327
MIRT539631	hsa-miR-329-3p	HITS-CLIP	23824327
MIRT539630	hsa-miR-362-3p	HITS-CLIP	23824327
MIRT539629	hsa-miR-603	HITS-CLIP	23824327
MIRT609359	hsa-miR-4643	HITS-CLIP	23824327
MIRT539628	hsa-miR-216b-3p	HITS-CLIP	23824327
MIRT539627	hsa-miR-3941	HITS-CLIP	23824327
MIRT539626	hsa-miR-4672	HITS-CLIP	23824327
MIRT539625	hsa-miR-466	HITS-CLIP	23824327
MIRT539624	hsa-miR-4789-5p	HITS-CLIP	23824327
MIRT539632	hsa-miR-8485	HITS-CLIP	23824327
MIRT539631	hsa-miR-329-3p	HITS-CLIP	23824327
MIRT539630	hsa-miR-362-3p	HITS-CLIP	23824327
MIRT539629	hsa-miR-603	HITS-CLIP	23824327
MIRT539628	hsa-miR-216b-3p	HITS-CLIP	23824327
MIRT539627	hsa-miR-3941	HITS-CLIP	23824327
MIRT539626	hsa-miR-4672	HITS-CLIP	23824327
MIRT539625	hsa-miR-466	HITS-CLIP	23824327
MIRT539632	hsa-miR-8485	HITS-CLIP	23824327
MIRT539631	hsa-miR-329-3p	HITS-CLIP	23824327
MIRT539630	hsa-miR-362-3p	HITS-CLIP	23824327
MIRT539629	hsa-miR-603	HITS-CLIP	23824327
MIRT539628	hsa-miR-216b-3p	HITS-CLIP	23824327
MIRT539627	hsa-miR-3941	HITS-CLIP	23824327
MIRT539626	hsa-miR-4672	HITS-CLIP	23824327
MIRT539625	hsa-miR-466	HITS-CLIP	23824327
MIRT539632	hsa-miR-8485	HITS-CLIP	23824327
MIRT539631	hsa-miR-329-3p	HITS-CLIP	23824327
MIRT539630	hsa-miR-362-3p	HITS-CLIP	23824327
MIRT539629	hsa-miR-603	HITS-CLIP	23824327
MIRT539628	hsa-miR-216b-3p	HITS-CLIP	23824327
MIRT539627	hsa-miR-3941	HITS-CLIP	23824327
MIRT539626	hsa-miR-4672	HITS-CLIP	23824327
MIRT539625	hsa-miR-466	HITS-CLIP	23824327
MIRT539624	hsa-miR-4789-5p	HITS-CLIP	23824327
MIRT539632	hsa-miR-8485	HITS-CLIP	23824327
MIRT539631	hsa-miR-329-3p	HITS-CLIP	23824327
MIRT539630	hsa-miR-362-3p	HITS-CLIP	23824327
MIRT539629	hsa-miR-603	HITS-CLIP	23824327
MIRT609359	hsa-miR-4643	HITS-CLIP	23824327
MIRT539628	hsa-miR-216b-3p	HITS-CLIP	23824327
MIRT539627	hsa-miR-3941	HITS-CLIP	23824327
MIRT539626	hsa-miR-4672	HITS-CLIP	23824327
MIRT539625	hsa-miR-466	HITS-CLIP	23824327
MIRT539624	hsa-miR-4789-5p	HITS-CLIP	23824327
MIRT539632	hsa-miR-8485	HITS-CLIP	23824327
MIRT539631	hsa-miR-329-3p	HITS-CLIP	23824327
MIRT539630	hsa-miR-362-3p	HITS-CLIP	23824327
MIRT539629	hsa-miR-603	HITS-CLIP	23824327
MIRT609359	hsa-miR-4643	HITS-CLIP	23824327
MIRT539628	hsa-miR-216b-3p	HITS-CLIP	23824327
MIRT539627	hsa-miR-3941	HITS-CLIP	23824327
MIRT539626	hsa-miR-4672	HITS-CLIP	23824327
MIRT539625	hsa-miR-466	HITS-CLIP	23824327
MIRT539624	hsa-miR-4789-5p	HITS-CLIP	23824327
MIRT539632	hsa-miR-8485	HITS-CLIP	23824327
MIRT539631	hsa-miR-329-3p	HITS-CLIP	23824327
MIRT539630	hsa-miR-362-3p	HITS-CLIP	23824327
MIRT539629	hsa-miR-603	HITS-CLIP	23824327
MIRT539628	hsa-miR-216b-3p	HITS-CLIP	23824327
MIRT539627	hsa-miR-3941	HITS-CLIP	23824327
MIRT539626	hsa-miR-4672	HITS-CLIP	23824327
MIRT539625	hsa-miR-466	HITS-CLIP	23824327
MIRT539624	hsa-miR-4789-5p	HITS-CLIP	23824327
MIRT539632	hsa-miR-8485	HITS-CLIP	23824327
MIRT539631	hsa-miR-329-3p	HITS-CLIP	23824327
MIRT539630	hsa-miR-362-3p	HITS-CLIP	23824327
MIRT539629	hsa-miR-603	HITS-CLIP	23824327
MIRT609359	hsa-miR-4643	HITS-CLIP	23824327
MIRT539628	hsa-miR-216b-3p	HITS-CLIP	23824327
MIRT539627	hsa-miR-3941	HITS-CLIP	23824327
MIRT539626	hsa-miR-4672	HITS-CLIP	23824327
MIRT539625	hsa-miR-466	HITS-CLIP	23824327
MIRT539624	hsa-miR-4789-5p	HITS-CLIP	23824327
MIRT539632	hsa-miR-8485	HITS-CLIP	23824327
MIRT539631	hsa-miR-329-3p	HITS-CLIP	23824327
MIRT539630	hsa-miR-362-3p	HITS-CLIP	23824327
MIRT539629	hsa-miR-603	HITS-CLIP	23824327
MIRT539628	hsa-miR-216b-3p	HITS-CLIP	23824327
MIRT539627	hsa-miR-3941	HITS-CLIP	23824327
MIRT539626	hsa-miR-4672	HITS-CLIP	23824327
MIRT539625	hsa-miR-466	HITS-CLIP	23824327
MIRT539624	hsa-miR-4789-5p	HITS-CLIP	23824327
MIRT539632	hsa-miR-8485	HITS-CLIP	23824327
MIRT539631	hsa-miR-329-3p	HITS-CLIP	23824327
MIRT539630	hsa-miR-362-3p	HITS-CLIP	23824327
MIRT539629	hsa-miR-603	HITS-CLIP	23824327
MIRT539628	hsa-miR-216b-3p	HITS-CLIP	23824327
MIRT539627	hsa-miR-3941	HITS-CLIP	23824327
MIRT539626	hsa-miR-4672	HITS-CLIP	23824327
MIRT539625	hsa-miR-466	HITS-CLIP	23824327
MIRT539624	hsa-miR-4789-5p	HITS-CLIP	23824327
MIRT539632	hsa-miR-8485	HITS-CLIP	23824327
MIRT539631	hsa-miR-329-3p	HITS-CLIP	23824327
MIRT539630	hsa-miR-362-3p	HITS-CLIP	23824327
MIRT539629	hsa-miR-603	HITS-CLIP	23824327
MIRT609359	hsa-miR-4643	HITS-CLIP	23824327
MIRT539628	hsa-miR-216b-3p	HITS-CLIP	23824327
MIRT539627	hsa-miR-3941	HITS-CLIP	23824327
MIRT539626	hsa-miR-4672	HITS-CLIP	23824327
MIRT539625	hsa-miR-466	HITS-CLIP	23824327
MIRT539624	hsa-miR-4789-5p	HITS-CLIP	23824327
MIRT539632	hsa-miR-8485	PAR-CLIP	20371350
MIRT539631	hsa-miR-329-3p	PAR-CLIP	20371350
MIRT539630	hsa-miR-362-3p	PAR-CLIP	20371350
MIRT539629	hsa-miR-603	PAR-CLIP	20371350
MIRT539628	hsa-miR-216b-3p	PAR-CLIP	20371350
MIRT539627	hsa-miR-3941	PAR-CLIP	20371350
MIRT539626	hsa-miR-4672	PAR-CLIP	20371350
MIRT539625	hsa-miR-466	PAR-CLIP	20371350
MIRT539632	hsa-miR-8485	PAR-CLIP	21572407
MIRT539631	hsa-miR-329-3p	PAR-CLIP	21572407
MIRT539630	hsa-miR-362-3p	PAR-CLIP	21572407
MIRT539629	hsa-miR-603	PAR-CLIP	21572407
MIRT539628	hsa-miR-216b-3p	PAR-CLIP	21572407
MIRT539627	hsa-miR-3941	PAR-CLIP	21572407
MIRT539626	hsa-miR-4672	PAR-CLIP	21572407
MIRT539625	hsa-miR-466	PAR-CLIP	21572407
MIRT539624	hsa-miR-4789-5p	PAR-CLIP	21572407
MIRT539628	hsa-miR-216b-3p	HITS-CLIP	27418678
MIRT539631	hsa-miR-329-3p	HITS-CLIP	27418678
MIRT539630	hsa-miR-362-3p	HITS-CLIP	27418678
MIRT539627	hsa-miR-3941	HITS-CLIP	27418678
MIRT539624	hsa-miR-4789-5p	HITS-CLIP	27418678
MIRT539629	hsa-miR-603	HITS-CLIP	27418678
MIRT539632	hsa-miR-8485	HITS-CLIP	27418678
MIRT539632	hsa-miR-8485	HITS-CLIP	23313552
MIRT539631	hsa-miR-329-3p	HITS-CLIP	23313552
MIRT539630	hsa-miR-362-3p	HITS-CLIP	23313552
MIRT539629	hsa-miR-603	HITS-CLIP	23313552
MIRT609359	hsa-miR-4643	HITS-CLIP	23313552
MIRT539628	hsa-miR-216b-3p	HITS-CLIP	23313552
MIRT539627	hsa-miR-3941	HITS-CLIP	23313552
MIRT539626	hsa-miR-4672	HITS-CLIP	23313552
MIRT539625	hsa-miR-466	HITS-CLIP	23313552
MIRT539632	hsa-miR-8485	HITS-CLIP	23824327
MIRT539631	hsa-miR-329-3p	HITS-CLIP	23824327
MIRT539630	hsa-miR-362-3p	HITS-CLIP	23824327
MIRT539629	hsa-miR-603	HITS-CLIP	23824327
MIRT539628	hsa-miR-216b-3p	HITS-CLIP	23824327
MIRT539627	hsa-miR-3941	HITS-CLIP	23824327
MIRT539626	hsa-miR-4672	HITS-CLIP	23824327
MIRT539625	hsa-miR-466	HITS-CLIP	23824327
MIRT539624	hsa-miR-4789-5p	HITS-CLIP	23824327
MIRT539632	hsa-miR-8485	HITS-CLIP	23824327
MIRT539631	hsa-miR-329-3p	HITS-CLIP	23824327
MIRT539630	hsa-miR-362-3p	HITS-CLIP	23824327
MIRT539629	hsa-miR-603	HITS-CLIP	23824327
MIRT539628	hsa-miR-216b-3p	HITS-CLIP	23824327
MIRT539627	hsa-miR-3941	HITS-CLIP	23824327
MIRT539626	hsa-miR-4672	HITS-CLIP	23824327
MIRT539625	hsa-miR-466	HITS-CLIP	23824327
MIRT539624	hsa-miR-4789-5p	HITS-CLIP	23824327
MIRT539632	hsa-miR-8485	HITS-CLIP	23824327
MIRT539631	hsa-miR-329-3p	HITS-CLIP	23824327
MIRT539630	hsa-miR-362-3p	HITS-CLIP	23824327
MIRT539629	hsa-miR-603	HITS-CLIP	23824327
MIRT609359	hsa-miR-4643	HITS-CLIP	23824327
MIRT539628	hsa-miR-216b-3p	HITS-CLIP	23824327
MIRT539627	hsa-miR-3941	HITS-CLIP	23824327
MIRT539626	hsa-miR-4672	HITS-CLIP	23824327
MIRT539625	hsa-miR-466	HITS-CLIP	23824327
MIRT539624	hsa-miR-4789-5p	HITS-CLIP	23824327
MIRT539632	hsa-miR-8485	HITS-CLIP	23824327
MIRT539631	hsa-miR-329-3p	HITS-CLIP	23824327
MIRT539630	hsa-miR-362-3p	HITS-CLIP	23824327
MIRT539629	hsa-miR-603	HITS-CLIP	23824327
MIRT539628	hsa-miR-216b-3p	HITS-CLIP	23824327
MIRT539627	hsa-miR-3941	HITS-CLIP	23824327
MIRT539626	hsa-miR-4672	HITS-CLIP	23824327
MIRT539625	hsa-miR-466	HITS-CLIP	23824327
MIRT539624	hsa-miR-4789-5p	HITS-CLIP	23824327
MIRT539632	hsa-miR-8485	HITS-CLIP	23824327
MIRT539631	hsa-miR-329-3p	HITS-CLIP	23824327
MIRT539630	hsa-miR-362-3p	HITS-CLIP	23824327
MIRT539629	hsa-miR-603	HITS-CLIP	23824327
MIRT609359	hsa-miR-4643	HITS-CLIP	23824327
MIRT539628	hsa-miR-216b-3p	HITS-CLIP	23824327
MIRT669849	hsa-miR-3622b-5p	HITS-CLIP	23824327
MIRT539627	hsa-miR-3941	HITS-CLIP	23824327
MIRT539626	hsa-miR-4672	HITS-CLIP	23824327
MIRT539625	hsa-miR-466	HITS-CLIP	23824327
MIRT539624	hsa-miR-4789-5p	HITS-CLIP	23824327
MIRT539632	hsa-miR-8485	HITS-CLIP	23824327
MIRT539631	hsa-miR-329-3p	HITS-CLIP	23824327
MIRT539630	hsa-miR-362-3p	HITS-CLIP	23824327
MIRT539629	hsa-miR-603	HITS-CLIP	23824327
MIRT609359	hsa-miR-4643	HITS-CLIP	23824327
MIRT539628	hsa-miR-216b-3p	HITS-CLIP	23824327
MIRT539627	hsa-miR-3941	HITS-CLIP	23824327
MIRT539626	hsa-miR-4672	HITS-CLIP	23824327
MIRT539625	hsa-miR-466	HITS-CLIP	23824327
MIRT539624	hsa-miR-4789-5p	HITS-CLIP	23824327
MIRT539632	hsa-miR-8485	HITS-CLIP	23824327
MIRT539631	hsa-miR-329-3p	HITS-CLIP	23824327
MIRT539630	hsa-miR-362-3p	HITS-CLIP	23824327
MIRT539629	hsa-miR-603	HITS-CLIP	23824327
MIRT539628	hsa-miR-216b-3p	HITS-CLIP	23824327
MIRT539627	hsa-miR-3941	HITS-CLIP	23824327
MIRT539626	hsa-miR-4672	HITS-CLIP	23824327
MIRT539625	hsa-miR-466	HITS-CLIP	23824327
MIRT539632	hsa-miR-8485	HITS-CLIP	23824327
MIRT539631	hsa-miR-329-3p	HITS-CLIP	23824327
MIRT539630	hsa-miR-362-3p	HITS-CLIP	23824327
MIRT539629	hsa-miR-603	HITS-CLIP	23824327
MIRT539628	hsa-miR-216b-3p	HITS-CLIP	23824327
MIRT539627	hsa-miR-3941	HITS-CLIP	23824327
MIRT539626	hsa-miR-4672	HITS-CLIP	23824327
MIRT539625	hsa-miR-466	HITS-CLIP	23824327
MIRT539624	hsa-miR-4789-5p	HITS-CLIP	23824327
MIRT539632	hsa-miR-8485	HITS-CLIP	23824327
MIRT539631	hsa-miR-329-3p	HITS-CLIP	23824327
MIRT539630	hsa-miR-362-3p	HITS-CLIP	23824327
MIRT539629	hsa-miR-603	HITS-CLIP	23824327
MIRT609359	hsa-miR-4643	HITS-CLIP	23824327
MIRT539628	hsa-miR-216b-3p	HITS-CLIP	23824327
MIRT539627	hsa-miR-3941	HITS-CLIP	23824327
MIRT539626	hsa-miR-4672	HITS-CLIP	23824327
MIRT539625	hsa-miR-466	HITS-CLIP	23824327
MIRT539624	hsa-miR-4789-5p	HITS-CLIP	23824327
MIRT539632	hsa-miR-8485	HITS-CLIP	23824327
MIRT539631	hsa-miR-329-3p	HITS-CLIP	23824327
MIRT539630	hsa-miR-362-3p	HITS-CLIP	23824327
MIRT539629	hsa-miR-603	HITS-CLIP	23824327
MIRT539628	hsa-miR-216b-3p	HITS-CLIP	23824327
MIRT539627	hsa-miR-3941	HITS-CLIP	23824327
MIRT539626	hsa-miR-4672	HITS-CLIP	23824327
MIRT539625	hsa-miR-466	HITS-CLIP	23824327
MIRT539632	hsa-miR-8485	HITS-CLIP	23824327
MIRT539631	hsa-miR-329-3p	HITS-CLIP	23824327
MIRT539630	hsa-miR-362-3p	HITS-CLIP	23824327
MIRT539629	hsa-miR-603	HITS-CLIP	23824327
MIRT539628	hsa-miR-216b-3p	HITS-CLIP	23824327
MIRT539627	hsa-miR-3941	HITS-CLIP	23824327
MIRT539626	hsa-miR-4672	HITS-CLIP	23824327
MIRT539625	hsa-miR-466	HITS-CLIP	23824327
MIRT539632	hsa-miR-8485	HITS-CLIP	23824327
MIRT539631	hsa-miR-329-3p	HITS-CLIP	23824327
MIRT539630	hsa-miR-362-3p	HITS-CLIP	23824327
MIRT539629	hsa-miR-603	HITS-CLIP	23824327
MIRT539628	hsa-miR-216b-3p	HITS-CLIP	23824327
MIRT539627	hsa-miR-3941	HITS-CLIP	23824327
MIRT539626	hsa-miR-4672	HITS-CLIP	23824327
MIRT539625	hsa-miR-466	HITS-CLIP	23824327
MIRT539624	hsa-miR-4789-5p	HITS-CLIP	23824327
MIRT539632	hsa-miR-8485	HITS-CLIP	23824327
MIRT539631	hsa-miR-329-3p	HITS-CLIP	23824327
MIRT539630	hsa-miR-362-3p	HITS-CLIP	23824327
MIRT539629	hsa-miR-603	HITS-CLIP	23824327
MIRT609359	hsa-miR-4643	HITS-CLIP	23824327
MIRT539628	hsa-miR-216b-3p	HITS-CLIP	23824327
MIRT539627	hsa-miR-3941	HITS-CLIP	23824327
MIRT539626	hsa-miR-4672	HITS-CLIP	23824327
MIRT539625	hsa-miR-466	HITS-CLIP	23824327
MIRT539624	hsa-miR-4789-5p	HITS-CLIP	23824327
MIRT539632	hsa-miR-8485	HITS-CLIP	23824327
MIRT539631	hsa-miR-329-3p	HITS-CLIP	23824327
MIRT539630	hsa-miR-362-3p	HITS-CLIP	23824327
MIRT539629	hsa-miR-603	HITS-CLIP	23824327
MIRT609359	hsa-miR-4643	HITS-CLIP	23824327
MIRT539628	hsa-miR-216b-3p	HITS-CLIP	23824327
MIRT539627	hsa-miR-3941	HITS-CLIP	23824327
MIRT539626	hsa-miR-4672	HITS-CLIP	23824327
MIRT539625	hsa-miR-466	HITS-CLIP	23824327
MIRT539624	hsa-miR-4789-5p	HITS-CLIP	23824327
MIRT539632	hsa-miR-8485	HITS-CLIP	23824327
MIRT539631	hsa-miR-329-3p	HITS-CLIP	23824327
MIRT539630	hsa-miR-362-3p	HITS-CLIP	23824327
MIRT539629	hsa-miR-603	HITS-CLIP	23824327
MIRT539628	hsa-miR-216b-3p	HITS-CLIP	23824327
MIRT539627	hsa-miR-3941	HITS-CLIP	23824327
MIRT539626	hsa-miR-4672	HITS-CLIP	23824327
MIRT539625	hsa-miR-466	HITS-CLIP	23824327
MIRT539624	hsa-miR-4789-5p	HITS-CLIP	23824327
MIRT539632	hsa-miR-8485	HITS-CLIP	23824327
MIRT539631	hsa-miR-329-3p	HITS-CLIP	23824327
MIRT539630	hsa-miR-362-3p	HITS-CLIP	23824327
MIRT539629	hsa-miR-603	HITS-CLIP	23824327
MIRT609359	hsa-miR-4643	HITS-CLIP	23824327
MIRT539628	hsa-miR-216b-3p	HITS-CLIP	23824327
MIRT539627	hsa-miR-3941	HITS-CLIP	23824327
MIRT539626	hsa-miR-4672	HITS-CLIP	23824327
MIRT539625	hsa-miR-466	HITS-CLIP	23824327
MIRT539624	hsa-miR-4789-5p	HITS-CLIP	23824327
MIRT539632	hsa-miR-8485	HITS-CLIP	23824327
MIRT539631	hsa-miR-329-3p	HITS-CLIP	23824327
MIRT539630	hsa-miR-362-3p	HITS-CLIP	23824327
MIRT539629	hsa-miR-603	HITS-CLIP	23824327
MIRT539628	hsa-miR-216b-3p	HITS-CLIP	23824327
MIRT539627	hsa-miR-3941	HITS-CLIP	23824327
MIRT539626	hsa-miR-4672	HITS-CLIP	23824327
MIRT539625	hsa-miR-466	HITS-CLIP	23824327
MIRT539624	hsa-miR-4789-5p	HITS-CLIP	23824327
MIRT539632	hsa-miR-8485	HITS-CLIP	23824327
MIRT539631	hsa-miR-329-3p	HITS-CLIP	23824327
MIRT539630	hsa-miR-362-3p	HITS-CLIP	23824327
MIRT539629	hsa-miR-603	HITS-CLIP	23824327
MIRT539628	hsa-miR-216b-3p	HITS-CLIP	23824327
MIRT539627	hsa-miR-3941	HITS-CLIP	23824327
MIRT539626	hsa-miR-4672	HITS-CLIP	23824327
MIRT539625	hsa-miR-466	HITS-CLIP	23824327
MIRT539624	hsa-miR-4789-5p	HITS-CLIP	23824327
MIRT539632	hsa-miR-8485	HITS-CLIP	23824327
MIRT539631	hsa-miR-329-3p	HITS-CLIP	23824327
MIRT539630	hsa-miR-362-3p	HITS-CLIP	23824327
MIRT539629	hsa-miR-603	HITS-CLIP	23824327
MIRT609359	hsa-miR-4643	HITS-CLIP	23824327
MIRT539628	hsa-miR-216b-3p	HITS-CLIP	23824327
MIRT539627	hsa-miR-3941	HITS-CLIP	23824327
MIRT539626	hsa-miR-4672	HITS-CLIP	23824327
MIRT539625	hsa-miR-466	HITS-CLIP	23824327
MIRT539624	hsa-miR-4789-5p	HITS-CLIP	23824327
MIRT539632	hsa-miR-8485	PAR-CLIP	20371350
MIRT539631	hsa-miR-329-3p	PAR-CLIP	20371350
MIRT539630	hsa-miR-362-3p	PAR-CLIP	20371350
MIRT539629	hsa-miR-603	PAR-CLIP	20371350
MIRT539628	hsa-miR-216b-3p	PAR-CLIP	20371350
MIRT539627	hsa-miR-3941	PAR-CLIP	20371350
MIRT539626	hsa-miR-4672	PAR-CLIP	20371350
MIRT539625	hsa-miR-466	PAR-CLIP	20371350
MIRT539632	hsa-miR-8485	PAR-CLIP	21572407
MIRT539631	hsa-miR-329-3p	PAR-CLIP	21572407
MIRT539630	hsa-miR-362-3p	PAR-CLIP	21572407
MIRT539629	hsa-miR-603	PAR-CLIP	21572407
MIRT539628	hsa-miR-216b-3p	PAR-CLIP	21572407
MIRT539627	hsa-miR-3941	PAR-CLIP	21572407
MIRT539626	hsa-miR-4672	PAR-CLIP	21572407
MIRT539625	hsa-miR-466	PAR-CLIP	21572407
MIRT539624	hsa-miR-4789-5p	PAR-CLIP	21572407
MIRT874005	hsa-miR-329	CLIP-seq
MIRT874006	hsa-miR-4720-5p	CLIP-seq
MIRT874007	hsa-miR-4799-3p	CLIP-seq
MIRT874005	hsa-miR-329	CLIP-seq

Transcription factors

Transcription factor	Regulation	Reference
APEX1	Activation	10666449
PAX5	Activation	15163413
PAX5	Unknown	10666449;12907641;20208555

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001923	Process	B-1 B cell differentiation	IEA
GO:0002250	Process	Adaptive immune response	IEA
GO:0002322	Process	B cell proliferation involved in immune response	IDA	1373518
GO:0002322	Process	B cell proliferation involved in immune response	IEA
GO:0002322	Process	B cell proliferation involved in immune response	IMP	16672701
GO:0002376	Process	Immune system process	IEA
GO:0005886	Component	Plasma membrane	IDA	16672701
GO:0005886	Component	Plasma membrane	IEA
GO:0005886	Component	Plasma membrane	TAS
GO:0009897	Component	External side of plasma membrane	IBA
GO:0009897	Component	External side of plasma membrane	IDA	17213291, 20660734
GO:0009897	Component	External side of plasma membrane	IEA
GO:0016020	Component	Membrane	IEA
GO:0016064	Process	Immunoglobulin mediated immune response	IMP	16672701
GO:0019724	Process	B cell mediated immunity	IEA
GO:0032991	Component	Protein-containing complex	IDA	23071339
GO:0042100	Process	B cell proliferation	ISS
GO:0042100	Process	B cell proliferation	ISS
GO:0045121	Component	Membrane raft	IEA
GO:0050851	Process	Antigen receptor-mediated signaling pathway	IDA	1373518
GO:0050853	Process	B cell receptor signaling pathway	IBA
GO:0050853	Process	B cell receptor signaling pathway	IEA
GO:0050853	Process	B cell receptor signaling pathway	ISS
GO:0050855	Process	Regulation of B cell receptor signaling pathway	IEA
GO:0050855	Process	Regulation of B cell receptor signaling pathway	IMP	9382888
GO:0050864	Process	Regulation of B cell activation	IDA	1373518
GO:0050864	Process	Regulation of B cell activation	IEA
GO:0051281	Process	Positive regulation of release of sequestered calcium ion into cytosol	IDA	16672701
GO:0051281	Process	Positive regulation of release of sequestered calcium ion into cytosol	IEA
GO:0051281	Process	Positive regulation of release of sequestered calcium ion into cytosol	IMP	9382888
GO:0051897	Process	Positive regulation of phosphatidylinositol 3-kinase/protein kinase B signal transduction	IEA
GO:0051897	Process	Positive regulation of phosphatidylinositol 3-kinase/protein kinase B signal transduction	IMP	9382888
GO:0070062	Component	Extracellular exosome	HDA	20458337

Other IDs

• MIM: 107265
• HGNC: 1633
• e!Ensembl: ENSG00000177455

Protein

• UniProt ID: P15391
• Protein name: B-lymphocyte antigen CD19 (B-lymphocyte surface antigen B4) (Differentiation antigen CD19) (T-cell surface antigen Leu-12) (CD antigen CD19)
• Protein function: Functions as a coreceptor for the B-cell antigen receptor complex (BCR) on B-lymphocytes (PubMed:29523808). Decreases the threshold for activation of downstream signaling pathways and for triggering B-cell responses to antigens (PubMed:1373518,
• PDB: 6AL5, 7JIC, 7URV, 7URX
• Tissue specificity: TISSUE SPECIFICITY: Detected on marginal zone and germinal center B cells in lymph nodes (PubMed:2463100). Detected on blood B cells (at protein level) (PubMed:16672701, PubMed:2463100). {ECO:0000269|PubMed:16672701, ECO:0000269|PubMed:2463100}.
• Sequence:

  MPPPRLLFFLLFLTPMEVRPEEPLVVKVEEGDNAVLQCLKGTSDGPTQQLTWSRESPLKP
  FLKLSLGLPGLGIHMRPLAIWLFIFNVSQQMGGFYLCQPGPPSEKAWQPGWTVNVEGSGE
  LFRWNVSDLGGLGCGLKNRSSEGPSSPSGKLMSPKLYVWAKDRPEIWEGEPPCLPPRDSL
  NQSLSQDLTMAPGSTLWLSCGVPPDSVSRGPLSWTHVHPKGPKSLLSLELKDDRPARDMW
  VMETGLLLPRATAQDAGKYYCHRGNLTMSFHLEITARPVLWHWLLRTGGWKVSAVTLAYL
  IFCLCSLVGILHLQRALVLRRKRKRMTDPTRRFFKVTPPPGSGPQNQYGNVLSLPTPTSG
  LGRAQRWAAGLGGTAPSYGNPSSDVQADGALGSRSPPGVGPEEEEGEGYEEPDSEEDSEF
  YENDSNLGQDQLSQDGSGYENPEDEPLGPEDEDSFSNAESYENEDEELTQPVARTMDFLS
  PHGSAWDPSREATSLGSQSYEDMRGILYAAPQLRSIRGQPGPNHEEDADSYENMDNPDGP
  DPAWGGGGRMGTWSTR

• Sequence length: 556

Pathways

KEGG:

PI3K-Akt signaling pathway
Hematopoietic cell lineage
B cell receptor signaling pathway
Epstein-Barr virus infection
Primary immunodeficiency

Reactome:

PIP3 activates AKT signaling
Immunoregulatory interactions between a Lymphoid and a non-Lymphoid cell
Constitutive Signaling by Aberrant PI3K in Cancer
PI5P, PP2A and IER3 Regulate PI3K/AKT Signaling
Regulation of Complement cascade
Antigen activates B Cell Receptor (BCR) leading to generation of second messengers

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Causal
Phenotype Name	Clinical Significance	dbSNP ID	RCV Accession	Evidence Score
Immunodeficiency, common variable, 3	Pathogenic; Likely pathogenic	rs1567506566, rs886037920, rs886037921, rs2152230798, rs1393707607, rs1596718225	RCV000240815 RCV000240828 RCV000240806 RCV000019670 RCV000019671 RCV001001588	★★★★★ ClinVar: Pathogenic / Likely Pathogenic (≥5 Variants)
Inherited Immunodeficiency Diseases	Likely pathogenic	rs758555433, rs1596712783	RCV001027553 RCV001027554	★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
ANTIBODY DEFICIENCY DUE TO DEFECT IN CD19	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CD19-related disorder	Likely benign; Uncertain significance; Conflicting classifications of pathogenicity; Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Common Variable Immune Deficiency, Recessive	Uncertain significance; Conflicting classifications of pathogenicity	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
COMMON VARIABLE IMMUNODEFICIENCY	—	CTD, Disgenet, GenCC CTD, Disgenet, GenCC CTD, Disgenet, GenCC	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
COMMON VARIABLE IMMUNODEFICIENCY PHENOTYPE DUE TO CD19/CD81 DEFICIENCY	—	Orphanet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
GLOMERULONEPHRITIS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Immunodeficiency, common variable, 2	Uncertain significance	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PARKINSON DISEASE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Acquired Hypogammaglobulinemia	Common Variable Immunodeficiency	CTD_human_DG	16672701		★☆☆☆☆ Found in Text Mining only
Acquired Hypogammaglobulinemia	Common Variable Immunodeficiency	BEFREE	16729790, 16763458		★☆☆☆☆ Found in Text Mining only
Acute Erythroblastic Leukemia	Erythroblastic Leukemia	BEFREE	10552966		★☆☆☆☆ Found in Text Mining only
Acute leukemia	Leukemia	BEFREE	1375695, 18803279, 21323891, 23193950, 30154788, 9479874		★☆☆☆☆ Found in Text Mining only
Acute lymphocytic leukemia	Lymphocytic Leukemia	BEFREE	10654022, 11264179, 12592332, 12801841, 1280479, 14961035, 1696310, 16979235, 17107913, 17656004, 17717597, 17855649, 19143872, 19238016, 21323891, 21348573, 22990208, 23193950, 2364166, 23841506, 25317870, 25675873, 25884180, 26099639, 27009300, 27323395, 27479233, 27744645, 27784674, 27855281, 28039267, 28225754, 28249141, 28286501, 28291388, 28382423, 28386390, 28453885, 28698205, 28888074, 29017060, 29018147, 29025266, 29082835, 29143249, 2917188, 29385376, 29490423, 29544528, 2959808, 29637550, 29641322, 29743179, 29766234, 29789639, 29808005, 29847570, 29895435, 30120708, 30187944, 30206753, 30221037, 30296188, 30394400, 30444200, 30539476, 30680780, 30714847, 30808634, 31074527, 31081970, 31090657, 31110096, 3118100, 31184238, 31195686, 31242389, 31261152, 31281894, 31282760, 31428935, 31465532, 31541890, 31554741, 31566728, 31622496, 31697826, 31779130, 31798590, 31808875, 31837735, 7478603, 7532767, 7686033, 7686604, 7687860, 8426468, 8562940, 8913730, 9050885, 9264381		★☆☆☆☆ Found in Text Mining only
Acute monocytic leukemia	Monocytic Leukemia	BEFREE	17662713, 20208555, 31247675, 9269784		★☆☆☆☆ Found in Text Mining only
Acute myeloid leukemia, minimal differentiation	Myeloid Leukemia	BEFREE	9002966		★☆☆☆☆ Found in Text Mining only
Acute myelomonocytic leukemia	Myelomonocytic Leukemia	BEFREE	9052378		★☆☆☆☆ Found in Text Mining only
Acute pancreatitis	Pancreatitis	BEFREE	30627533		★☆☆☆☆ Found in Text Mining only
Acute Promyelocytic Leukemia	Promyelocytic Leukemia	BEFREE	1709379, 18333845		★☆☆☆☆ Found in Text Mining only
Adrenoleukodystrophy	Adrenoleukodystrophy	BEFREE	26429926		★☆☆☆☆ Found in Text Mining only
Adult Acute Lymphocytic Leukemia	Lymphocytic Leukemia	BEFREE	10654022, 11264179, 12592332, 12801841, 1280479, 14961035, 16979235, 17656004, 21348573, 22990208, 2364166, 23841506, 25317870, 25455270, 25884180, 27323395, 27479233, 27784674, 28249141, 28453885, 29025266, 29082835, 2917188, 29544528, 2959808, 29641322, 29808005, 30120708, 30394400, 30444200, 30880998, 31074527, 31081970, 3118100, 31205644, 31261152, 31383408, 31428935, 31554741, 31697826, 31779130, 31808875, 7532767, 7686604, 8426468, 8562940, 8913730, 9264381		★☆☆☆☆ Found in Text Mining only
Adult Diffuse Large B-Cell Lymphoma	B-cell Lymphoma	BEFREE	24938766, 27056922, 28153859, 28484276, 28803861, 29024301, 29174982, 29226764, 29910620, 30089630, 30362020, 30559740, 30680780, 30735463, 31431700, 31753002, 31837735		★☆☆☆☆ Found in Text Mining only
Adult Hodgkin Lymphoma	Hodgkin Lymphoma	BEFREE	28497159, 29165008, 30394400, 30632631		★☆☆☆☆ Found in Text Mining only
Agammaglobulinemia	Agammaglobulinemia	CTD_human_DG	16672701		★☆☆☆☆ Found in Text Mining only
Agammaglobulinemia	Agammaglobulinemia	Pubtator	16672701, 21693761, 26325596, 37246174	Associate	★☆☆☆☆ Found in Text Mining only
Agammaglobulinemia	Agammaglobulinemia	BEFREE	21693761, 31793170		★☆☆☆☆ Found in Text Mining only
Allergic rhinitis (disorder)	Allergic rhinitis	BEFREE	22444247, 29046188		★☆☆☆☆ Found in Text Mining only
alpha Thalassemia	Alpha thalassemia	Pubtator	14508795	Associate	★☆☆☆☆ Found in Text Mining only
alpha-Thalassemia	alpha Thalassemia	BEFREE	14508795		★☆☆☆☆ Found in Text Mining only
alpha^+^ Thalassemia	alpha Thalassemia	BEFREE	14508795		★☆☆☆☆ Found in Text Mining only
Amyloidosis	Amyloidosis	BEFREE	16515886		★☆☆☆☆ Found in Text Mining only
Androgen Insensitivity Syndrome	Androgen insensitivity syndrome	Pubtator	31598989	Inhibit	★☆☆☆☆ Found in Text Mining only
Anemia Aplastic	Aplastic anemia	Pubtator	20647647	Inhibit	★☆☆☆☆ Found in Text Mining only
Anemia, Hemolytic	Anemia	HPO_DG			★☆☆☆☆ Found in Text Mining only
Anemia, Sickle Cell	Anemia	BEFREE	31431703		★☆☆☆☆ Found in Text Mining only
Aneuploidy	Aneuploidy	Pubtator	32881995	Associate	★☆☆☆☆ Found in Text Mining only
Angina Unstable	Angina pectoris	Pubtator	7594025	Associate	★☆☆☆☆ Found in Text Mining only
Ankylosing spondylitis	Ankylosing Spondylitis	BEFREE	28683133		★☆☆☆☆ Found in Text Mining only
Anophthalmia with pulmonary hypoplasia	Anophthalmia	Pubtator	33237432	Associate	★☆☆☆☆ Found in Text Mining only
Antibody Deficiency due to Defect in CD19	Common variable immunodeficiency	GENOMICS_ENGLAND_DG	21159371		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Antibody Deficiency due to Defect in CD19	Common variable immunodeficiency	CLINVAR_DG			★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Antiphospholipid Syndrome	Antiphospholipid syndrome	Pubtator	30864219	Associate	★☆☆☆☆ Found in Text Mining only
Anus, Imperforate	Imperforate anus	HPO_DG			★☆☆☆☆ Found in Text Mining only
Aortic Aneurysm, Abdominal	Aortic Aneurysm	BEFREE	28223220		★☆☆☆☆ Found in Text Mining only
Aplastic Anemia	Aplastic anemia	BEFREE	9580207		★☆☆☆☆ Found in Text Mining only
Arteriosclerosis	Arteriosclerosis	BEFREE	31480861		★☆☆☆☆ Found in Text Mining only
Arthritis	Arthritis	Pubtator	33168080	Associate	★☆☆☆☆ Found in Text Mining only
Arthritis Juvenile	Juvenile arthritis	Pubtator	33042130	Associate	★☆☆☆☆ Found in Text Mining only
Arthritis Psoriatic	Psoriatic arthritis	Pubtator	24100919	Associate	★☆☆☆☆ Found in Text Mining only
Arthritis Rheumatoid	Rheumatoid arthritis	Pubtator	21128999, 21607290, 25639560, 28426141, 30327652, 30686934, 31554310, 32082002, 33483588, 33897713, 34079550, 34558072, 39925810	Associate	★☆☆☆☆ Found in Text Mining only
Arthritis Rheumatoid	Rheumatoid arthritis	Pubtator	39290322	Inhibit	★☆☆☆☆ Found in Text Mining only
Arthritis, Psoriatic	Psoriatic Arthritis	BEFREE	28461105, 31209492		★☆☆☆☆ Found in Text Mining only
Asthma	Asthma	BEFREE	12197574, 28730377, 29046188, 29115454		★☆☆☆☆ Found in Text Mining only
Asthma	Asthma	Pubtator	40234829	Associate	★☆☆☆☆ Found in Text Mining only
Atherosclerosis	Atherosclerosis	BEFREE	31480861		★☆☆☆☆ Found in Text Mining only
Autoimmune Diseases	Autoimmune Diseases	BEFREE	11086109, 15277237, 16217038, 18650480, 20175836, 21323891, 21545850, 23821660, 23885836, 24431284, 26606525, 27925187, 28153605, 29181820, 31026092, 9382890		★☆☆☆☆ Found in Text Mining only
Autoimmune Diseases	Autoimmune disease	Pubtator	21128999, 33391273, 33853929, 39530971	Associate	★☆☆☆☆ Found in Text Mining only
Autoimmune Diseases of the Nervous System	Autoimmune nervous system disorder	Pubtator	40352922	Associate	★☆☆☆☆ Found in Text Mining only
B Acute Lymphoblastic Leukemia with t(9;22)(q34.1;q11.2); BCR-ABL1	Lymphoblastic Leukemia	BEFREE	18704194, 25108652, 29809305		★☆☆☆☆ Found in Text Mining only
B-Cell Lymphomas	B-Cell Lymphoma	BEFREE	10878363, 16926291, 17046711, 20678160, 21540550, 22826319, 23872144, 23992830, 24623129, 24938766, 25427612, 28000533, 28110394, 28153605, 28228105, 28257957, 28301076, 28608720, 28857075, 29065420, 29226797, 29340102, 29632712, 29743205, 29766234, 29910620, 29920129, 29940805, 30002144, 30048860, 30078440, 30111631, 30213399, 30413526, 30427551, 30501490, 30557517, 30560413, 30733273, 30782611, 30837712, 30915277, 30919158, 30938714, 30979721, 31011207, 31195686, 31275852, 31356845, 31372000, 31439577, 31446199, 31482064, 31555598, 31585984, 31624374, 31648957, 31650026, 31677848, 31697310, 31712432, 31722870, 31805184, 9058731		★☆☆☆☆ Found in Text Mining only
B-CELL MALIGNANCY, LOW-GRADE	Lymphocytic Leukemia	BEFREE	12411322, 12802927, 1282428, 15370224, 1581232, 17449237, 20072155, 20566844, 20813001, 23419703, 24698102, 29087466, 30206753, 7543067, 9109943		★☆☆☆☆ Found in Text Mining only
Behcet Syndrome	Behcet disease	Pubtator	8814751	Associate	★☆☆☆☆ Found in Text Mining only
beta Thalassemia	beta Thalassemia	BEFREE	15599663		★☆☆☆☆ Found in Text Mining only
beta Thalassemia	Beta thalassemia	Pubtator	16103715	Associate	★☆☆☆☆ Found in Text Mining only
beta^+^ Thalassemia	beta Thalassemia	BEFREE	15599663		★☆☆☆☆ Found in Text Mining only
Bile Duct Neoplasms	Bile duct neoplasms	Pubtator	29584696	Stimulate	★☆☆☆☆ Found in Text Mining only
Blast Crisis	Blast crisis	Pubtator	34764108	Associate	★☆☆☆☆ Found in Text Mining only
Brachycephaly	Brachycephaly	HPO_DG			★☆☆☆☆ Found in Text Mining only
Brain Edema	Brain edema	Pubtator	35650594	Stimulate	★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	20061819, 22308039, 24736554, 27762298, 37684436	Associate	★☆☆☆☆ Found in Text Mining only
Bronchiectasis	Bronchiectasis	HPO_DG			★☆☆☆☆ Found in Text Mining only
Bronchiolitis	Bronchiolitis	BEFREE	28257632		★☆☆☆☆ Found in Text Mining only
Bronchiolitis	Bronchiolitis	Pubtator	28257632	Stimulate	★☆☆☆☆ Found in Text Mining only
Bruton type agammaglobulinemia	Bruton type agammaglobulinemia	Pubtator	1652799, 21905506, 25316352, 7506482, 8833898	Associate	★☆☆☆☆ Found in Text Mining only
Burkitt Leukemia	Burkitt`s Lymphoma	BEFREE	29076142, 30842058, 31722870		★☆☆☆☆ Found in Text Mining only
Burkitt Lymphoma	Burkitt`s Lymphoma	BEFREE	11133022, 12077238, 15842655, 21878902, 23341189, 2850450, 29669863, 31772298, 8209868		★☆☆☆☆ Found in Text Mining only
Burkitt Lymphoma	Burkitt lymphoma	Pubtator	15842655, 25612555, 29669863, 33631963	Associate	★☆☆☆☆ Found in Text Mining only
Calcinosis	Calcinosis	Pubtator	21332337	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Ductal Breast	Ductal carcinoma of breast	Pubtator	25007177	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	15182435, 31663864, 32170378, 33230233, 34958112	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma of lung	Lung carcinoma	BEFREE	30851071		★☆☆☆☆ Found in Text Mining only
Carcinoma Renal Cell	Renal cell carcinoma	Pubtator	32012488, 40076777	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Squamous Cell	Squamous cell carcinoma	Pubtator	21769085	Associate	★☆☆☆☆ Found in Text Mining only
Cardiomyopathies	Cardiomyopathy	Pubtator	12118194	Stimulate	★☆☆☆☆ Found in Text Mining only
Cardiomyopathy Dilated	Dilated cardiomyopathy	Pubtator	12118194	Associate	★☆☆☆☆ Found in Text Mining only
Cardiomyopathy Dilated	Dilated cardiomyopathy	Pubtator	26339378	Stimulate	★☆☆☆☆ Found in Text Mining only
Cardiovascular Diseases	Cardiovascular Diseases	BEFREE	29769621		★☆☆☆☆ Found in Text Mining only
Carney Complex	Carney complex	Pubtator	27897048, 35658223, 37122702, 37151356	Associate	★☆☆☆☆ Found in Text Mining only
Carney Complex	Carney Complex	BEFREE	30366924		★☆☆☆☆ Found in Text Mining only
Cataract	Cataract	BEFREE	10469047		★☆☆☆☆ Found in Text Mining only
Celiac Disease	Celiac disease	BEFREE	18360280, 28166225		★☆☆☆☆ Found in Text Mining only
Celiac Disease	Celiac disease	Pubtator	28166225	Associate	★☆☆☆☆ Found in Text Mining only
Childhood Acute Lymphoblastic Leukemia	Lymphoblastic Leukemia	BEFREE	10654022, 11264179, 12592332, 12801841, 1280479, 14961035, 1531305, 15735032, 16184615, 16979235, 17656004, 19147788, 21348573, 22990208, 23426279, 2364166, 23841506, 25317870, 25884180, 27323395, 27479233, 27784674, 28249141, 28453885, 29025266, 29082835, 2917188, 29544528, 2959808, 29641322, 29772353, 29808005, 30120708, 30212291, 30394400, 30444200, 30764841, 31012549, 31074527, 31081970, 3118100, 31261152, 31428935, 31554741, 31697826, 31779130, 31808875, 7532767, 7686604, 8426468, 8562940, 8913730, 9264381		★☆☆☆☆ Found in Text Mining only
Childhood Acute Myeloid Leukemia	Acute Myeloid Leukemia	BEFREE	17662713		★☆☆☆☆ Found in Text Mining only
Cholangiocarcinoma	Cholangiocarcinoma	Pubtator	29584696	Associate	★☆☆☆☆ Found in Text Mining only
Chronic kidney disease stage 5	Kidney Disease	BEFREE	22617684		★☆☆☆☆ Found in Text Mining only
Chronic Kidney Diseases	Kidney Disease	BEFREE	31122854		★☆☆☆☆ Found in Text Mining only
Chronic Lymphocytic Leukemia	Lymphocytic Leukemia	BEFREE	10673741, 12149225, 12239136, 12411322, 12444172, 12737946, 12801841, 12802927, 1282428, 1375109, 14630808, 15370224, 1581232, 15902296, 16225771, 16314473, 16334487, 16487171, 17038534, 17119117, 17449237, 17786715, 18431797, 18621559, 19074730, 19238016, 19683518, 19901553, 19965644, 20072155, 20215548, 20566844, 20595513, 20813001, 20936047, 2112977, 21133733, 21307146, 21406718, 21551245, 21795749, 21832238, 21908424, 22534504, 22591386, 23172082, 23241880, 23296468, 23419703, 23475845, 23561477, 2361698, 24289109, 24352938, 24373626, 24597981, 24698102, 24706380, 25455270, 25584781, 25675873, 25880332, 25911969, 26065479, 26065654, 26099639, 26574400, 26759369, 26968709, 27074565, 27078856, 27354412, 27479233, 27535994, 27689399, 27887866, 28110394, 28257957, 28301076, 28715249, 28826693, 29039115, 29087466, 29315094, 29503204, 29620951, 29670635, 29685162, 29713085, 29743179, 29766234, 29849141, 29893517, 29910179, 30024314, 30078440, 30206753, 30261221, 30737788, 30890546, 30942469, 31076448, 31081970, 31611950, 31690821, 31847470, 7492789, 7543067, 9109943		★☆☆☆☆ Found in Text Mining only
Chronic otitis media	Otitis media	HPO_DG			★☆☆☆☆ Found in Text Mining only
Chronic Periodontitis	Periodontitis	BEFREE	30922293		★☆☆☆☆ Found in Text Mining only
Chronic Periodontitis	Periodontitis	Pubtator	30922293	Associate	★☆☆☆☆ Found in Text Mining only
Cleft Palate	Cleft palate	Pubtator	30688042	Associate	★☆☆☆☆ Found in Text Mining only
CNS disorder	CNS Disorder	BEFREE	21606482		★☆☆☆☆ Found in Text Mining only
Colitis Ulcerative	Ulcerative colitis	Pubtator	22253520	Associate	★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	35112314, 39739032, 40056505	Associate	★☆☆☆☆ Found in Text Mining only
Common Variable Immunodeficiency	Common Variable Immunodeficiency	BEFREE	12100033, 16729790, 16763458, 17304884, 17697196, 17882224, 18051214, 18254984, 18561200, 19210517, 19738033, 21905497, 24888602, 31103252, 31284281		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Common Variable Immunodeficiency	Common variable immunodeficiency	Pubtator	12100033, 18254984, 18561200, 19210517, 21905497, 33679693, 33859323	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Common Variable Immunodeficiency	Common Variable Immunodeficiency	CTD_human_DG	16672701		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Common Variable Immunodeficiency	Common Variable Immunodeficiency	ORPHANET_DG			★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Common variable immunodeficiency	Common Variable Immunodeficiency	Orphanet			★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Congenital chromosomal disease	Congenital Chromosomal Disease	BEFREE	1378322, 14692523, 19882758		★☆☆☆☆ Found in Text Mining only
Conjunctivitis	Conjunctivitis	HPO_DG			★☆☆☆☆ Found in Text Mining only
Conventional (Clear Cell) Renal Cell Carcinoma	Renal Carcinoma	BEFREE	27812180		★☆☆☆☆ Found in Text Mining only
Coronary Artery Disease	Coronary artery disease	Pubtator	11882051	Stimulate	★☆☆☆☆ Found in Text Mining only
Coronary Artery Disease	Coronary artery disease	BEFREE	29769621		★☆☆☆☆ Found in Text Mining only
Craniosynostosis	Craniosynostosis	BEFREE	28126984, 28187946, 28506444, 28924019, 29481659, 29499750, 29625831, 29766234, 30463995, 30482769, 30504288, 30563981, 30769193, 31011207, 31431714, 31477906, 31502163, 31697826		★☆☆☆☆ Found in Text Mining only
Crohn Disease	Crohn Disease	BEFREE	12215898, 19664152, 29421816		★☆☆☆☆ Found in Text Mining only
Crohn Disease	Crohn disease	Pubtator	7506695	Associate	★☆☆☆☆ Found in Text Mining only
Degenerative polyarthritis	Arthritis	BEFREE	30408629, 31624962		★☆☆☆☆ Found in Text Mining only
Delirium	Delirium	BEFREE	31851018		★☆☆☆☆ Found in Text Mining only
Depressive Disorder	Major depressive disorder	Pubtator	30971748	Stimulate	★☆☆☆☆ Found in Text Mining only
Dermatitis	Dermatitis	BEFREE	23630391		★☆☆☆☆ Found in Text Mining only
Dermatitis Atopic	Atopic dermatitis	Pubtator	10651987	Associate	★☆☆☆☆ Found in Text Mining only
Diabetes	Diabetes	BEFREE	30518692		★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes Mellitus	BEFREE	16437243, 30518692		★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes mellitus	Pubtator	33230233	Associate	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus Type 1	Diabetes mellitus, type 1	Pubtator	15030582	Associate	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Insulin-Dependent	Diabetes Mellitus	BEFREE	28509690, 28635624, 30518692		★☆☆☆☆ Found in Text Mining only
Diffuse Large B-Cell Lymphoma	Diffuse Lymphoma	BEFREE	14681948, 15842045, 16430470, 2112977, 21615612, 23341189, 24147568, 24722400, 24938766, 26498772, 27056922, 28153859, 28484276, 28803861, 29024301, 29058502, 29174982, 29226764, 29909914, 29910620, 30089630, 30120708, 30275435, 30362020, 30559740, 30572564, 30622321, 30680780, 30735463, 31019670, 31170111, 31431700, 31753002, 31779130, 31837735		★☆☆☆☆ Found in Text Mining only
Down Syndrome	Down Syndrome	BEFREE	1825795, 19882758, 28197808		★☆☆☆☆ Found in Text Mining only
Down Syndrome	Down syndrome	Pubtator	19882758, 25222269, 34545294	Associate	★☆☆☆☆ Found in Text Mining only
Emphysema	Emphysema	Pubtator	33535173	Associate	★☆☆☆☆ Found in Text Mining only
Endometriosis	Endometriosis	BEFREE	23553198		★☆☆☆☆ Found in Text Mining only
Enteropathy-Associated T-Cell Lymphoma	Enteropathy-Associated T-Cell Lymphoma	BEFREE	18360280		★☆☆☆☆ Found in Text Mining only
Epidermodysplasia Verruciformis	Epidermodysplasia verruciformis	Pubtator	35202881	Associate	★☆☆☆☆ Found in Text Mining only
Epidermolysis Bullosa	Epidermolysis bullosa	Pubtator	10811835	Associate	★☆☆☆☆ Found in Text Mining only
Episodic Ataxia Type 2	Episodic ataxia	Pubtator	11179022	Associate	★☆☆☆☆ Found in Text Mining only
Fatigue Syndrome Chronic	Fatigue syndrome	Pubtator	27245705	Associate	★☆☆☆☆ Found in Text Mining only
Gastritis Atrophic	Gastritis	Pubtator	35905420	Associate	★☆☆☆☆ Found in Text Mining only
Gastrointestinal Stromal Tumors	Gastrointestinal stromal tumor	HPO_DG			★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	BEFREE	31355493		★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	Pubtator	8317546	Inhibit	★☆☆☆☆ Found in Text Mining only
Glioblastoma Multiforme	Glioblastoma	BEFREE	31355493		★☆☆☆☆ Found in Text Mining only
Glomerulonephritis IGA	Iga nephropathy	Pubtator	18650480, 21332337, 24219615, 33319642	Associate	★☆☆☆☆ Found in Text Mining only
Graft vs Host Disease	Graft-versus-host disease	Pubtator	23507469	Inhibit	★☆☆☆☆ Found in Text Mining only
Graft vs Host Disease	Graft-versus-host disease	Pubtator	28002337, 30349527, 33725422	Associate	★☆☆☆☆ Found in Text Mining only
Graft-vs-Host Disease	Graft-Vs-Host Disease	BEFREE	23507469, 25977584, 28067900, 29507075, 31558465		★☆☆☆☆ Found in Text Mining only
Graves Disease	Graves disease	Pubtator	23189166, 29259988, 30956992, 33987447	Associate	★☆☆☆☆ Found in Text Mining only
Graves Disease	Graves Disease	BEFREE	25894310, 28284988, 31554206		★☆☆☆☆ Found in Text Mining only
Graves Disease	Graves disease	Pubtator	40155866	Stimulate	★☆☆☆☆ Found in Text Mining only
Hairy Cell Leukemia	Hairy Cell Leukemia	BEFREE	1847340, 28512562, 7985490		★☆☆☆☆ Found in Text Mining only
Hashimoto Disease	Hashimoto Disease	BEFREE	28440417		★☆☆☆☆ Found in Text Mining only
Hashimoto Disease	Hashimoto disease	Pubtator	36982416, 40022006	Associate	★☆☆☆☆ Found in Text Mining only
Heart Diseases	Heart disease	Pubtator	38003044	Associate	★☆☆☆☆ Found in Text Mining only
Heart Failure	Heart failure	Pubtator	34868339, 37684436	Associate	★☆☆☆☆ Found in Text Mining only
Heart Valve Diseases	Heart valve disease	Pubtator	27553592	Associate	★☆☆☆☆ Found in Text Mining only
Hematologic Diseases	Hematologic disease	Pubtator	37295816	Associate	★☆☆☆☆ Found in Text Mining only
Hematologic Neoplasms	Hematologic Neoplasms	BEFREE	18829563, 23885836, 24771045, 27207800, 27548616, 27967241, 28025978, 28128714, 28233151, 28421069, 28837681, 28871274, 28877899, 28971751, 28978751, 29085357, 29119551, 29143249, 29329591, 29364163, 29554494, 29625831, 29769134, 29861325, 30386740, 30406956, 30632631, 30796733, 30906625, 30948292, 30973486, 30981835, 30984613, 31005597, 31186046, 31189721, 31190844, 31396933, 31779130		★☆☆☆☆ Found in Text Mining only
Hematologic Neoplasms	Hematologic neoplasm	Pubtator	24952935, 34337077, 35127255, 38142942	Associate	★☆☆☆☆ Found in Text Mining only
Hemoglobinopathies	Hemoglobinopathy	BEFREE	15599663, 31431703		★☆☆☆☆ Found in Text Mining only
Hepatitis C	Hepatitis c	Pubtator	31279905	Associate	★☆☆☆☆ Found in Text Mining only
Hepatitis C Chronic	Hepatitis c	Pubtator	33230233	Associate	★☆☆☆☆ Found in Text Mining only
High Grade Lymphoma (neoplasm)	High Grade Lymphoma	BEFREE	3509751		★☆☆☆☆ Found in Text Mining only
Hodgkin Disease	Hodgkin disease	Pubtator	16304050	Inhibit	★☆☆☆☆ Found in Text Mining only
Hodgkin Disease	Hodgkin Disease	BEFREE	16430470, 18829563, 24338745, 27744645, 28497159, 29165008, 30309819, 30394400, 30632631, 31690821		★☆☆☆☆ Found in Text Mining only
Hodgkin Disease	Hodgkin Disease	LHGDN	16430470		★☆☆☆☆ Found in Text Mining only
Hodgkin Disease	Hodgkin disease	Pubtator	27733358, 34807923	Associate	★☆☆☆☆ Found in Text Mining only
Hyper-IgM Immunodeficiency Syndrome, Type 1	Hyper-IgM Immunodeficiency Syndrome	BEFREE	11414747		★☆☆☆☆ Found in Text Mining only
Hypercalcemia	Hypercalcemia	BEFREE	15170892		★☆☆☆☆ Found in Text Mining only
Hyperhomocysteinemia	Hyperhomocysteinemia	BEFREE	31480861		★☆☆☆☆ Found in Text Mining only
Hyperlipoproteinemia Type I	Hyperlipoproteinemia	BEFREE	31282760		★☆☆☆☆ Found in Text Mining only
Hypertrophy	Hypertrophy	Pubtator	26319791	Associate	★☆☆☆☆ Found in Text Mining only
Hypogammaglobulinemia	Hypogammaglobulinemia	BEFREE	12215898, 16672701, 1849806, 29230214, 29447988, 30466771, 31416717		★☆☆☆☆ Found in Text Mining only
Hypogammaglobulinemia	Hypogammaglobulinemia	CTD_human_DG	16672701		★☆☆☆☆ Found in Text Mining only
Hypogammaglobulinemia	Hypogammaglobulinemia	GENOMICS_ENGLAND_DG	21159371		★☆☆☆☆ Found in Text Mining only
Idiopathic Membranous Glomerulonephritis	Membranous Glomerulonephritis	BEFREE	15954921		★☆☆☆☆ Found in Text Mining only
Idiopathic Pulmonary Fibrosis	Idiopathic pulmonary fibrosis	Pubtator	33925174	Stimulate	★☆☆☆☆ Found in Text Mining only
IgA Deficiency	Selective immunoglobulin a deficiency	Pubtator	19738033, 29755476	Associate	★☆☆☆☆ Found in Text Mining only
IGA Glomerulonephritis	Glomerulonephritis	BEFREE	18650480, 31275443, 31402200, 31670996		★☆☆☆☆ Found in Text Mining only
Immune thrombocytopenic purpura	Immune Thrombocytopenic Purpura	BEFREE	23239407, 24889407, 24911453, 27210424		★☆☆☆☆ Found in Text Mining only
Immune thrombocytopenic purpura	Immune Thrombocytopenic Purpura	HPO_DG			★☆☆☆☆ Found in Text Mining only
Immunoglobulin Deficiency, Late-Onset	Immunoglobulin Deficiency	CTD_human_DG	16672701		★☆☆☆☆ Found in Text Mining only
Immunologic Deficiency Syndromes	Immunologic Deficiency Syndromes	BEFREE	1370213, 17107913, 18851688, 19147788, 19238016, 21838572, 23620405		★☆☆☆☆ Found in Text Mining only
Immunologic Deficiency Syndromes	Immunologic Deficiency Syndromes	HPO_DG			★☆☆☆☆ Found in Text Mining only
Inflammatory Bowel Disease 25 Autosomal Recessive	Inflammatory bowel disease	Pubtator	26193622	Associate	★☆☆☆☆ Found in Text Mining only
Inflammatory Bowel Diseases	Inflammatory Bowel Disease	BEFREE	19664152		★☆☆☆☆ Found in Text Mining only
Inflammatory Bowel Diseases	Inflammatory bowel disease	Pubtator	29991969	Associate	★☆☆☆☆ Found in Text Mining only
Inflammatory dermatosis	Dermatitis	BEFREE	23630391		★☆☆☆☆ Found in Text Mining only
Kidney Failure Chronic	Kidney failure	Pubtator	15320911, 7517719	Associate	★☆☆☆☆ Found in Text Mining only
Kidney Failure, Chronic	Kidney Failure	BEFREE	22617684		★☆☆☆☆ Found in Text Mining only
Lattice corneal dystrophy Type I	Lattice corneal dystrophy	BEFREE	9432023		★☆☆☆☆ Found in Text Mining only
Leukemia	Leukemia	Pubtator	11418478, 12599181, 12673718, 1378322, 16939815, 18227839, 19561539, 19605331, 19951974, 22031866, 23193950, 23992830, 2460871, 2496771, 25189715, 27708227, 2784064, 28408462, 28441264, 28725044, 2917188, 29720486, 30275568, 30860496, 31738832, 32241852, 32245502, 3257143, 33558546, 34289897, 34337077, 34478871, 34706776, 35222407, 35226982, 35421218, 35759797, 36003375, 36138187, 36255409, 36361619, 36516256, 36875548, 37253111, 37757633, 38135346, 38243626, 38640253, 7795240, 8286840, 8683901, 8863659, 9207434	Associate	★☆☆☆☆ Found in Text Mining only
leukemia	Leukemia	BEFREE	11426630, 12091359, 12393484, 1370213, 1375109, 15507526, 15863212, 17875504, 18227839, 18829563, 19147788, 19238016, 19638467, 19719389, 19901553, 20028384, 20387166, 21622646, 21838572, 22990208, 23233573, 23295945, 23296468, 23296936, 23426279, 23992830, 24338745, 24365143, 24888271, 25538041, 26041741, 26301816, 27255991, 27258611, 27479233, 27846391, 27860544, 27907031, 28453885, 28456379, 28494518, 28515942, 28708956, 28762313, 29076142, 29107016, 29155426, 29207878, 29298756, 29451276, 29458388, 29743205, 30097433, 30275568, 30413825, 30479831, 30539529, 30622115, 30733273, 30828333, 30860496, 31738832, 7678881, 7920215, 8426468, 9566763		★☆☆☆☆ Found in Text Mining only
leukemia	Leukemia	LHGDN	15144712, 15549146		★☆☆☆☆ Found in Text Mining only
Leukemia	Leukemia	Pubtator	31201998, 35950535	Inhibit	★☆☆☆☆ Found in Text Mining only
Leukemia Hairy Cell	Hairy cell leukemia	Pubtator	10414592, 10419901, 7688993, 9708202	Associate	★☆☆☆☆ Found in Text Mining only
Leukemia Myeloid Acute	Myeloid leukemia	Pubtator	1378322, 17488160, 19605331, 19882758, 21474990, 23193950, 23616623, 24528030, 26907630, 27907031, 28134942, 31439679, 33382538, 34793513, 35409391, 39192973, 9395193	Associate	★☆☆☆☆ Found in Text Mining only
Leukemia Myeloid Acute	Myeloid leukemia	Pubtator	29720486	Inhibit	★☆☆☆☆ Found in Text Mining only
Leukemia Promyelocytic Acute	Promyelocytic leukemia	Pubtator	9734655	Associate	★☆☆☆☆ Found in Text Mining only
Leukemia, Myelocytic, Acute	Leukemia	BEFREE	11426630, 12682630, 12801841, 1378322, 1382546, 1419814, 14692523, 16393685, 16891199, 17662713, 17875504, 18333845, 1921460, 19882758, 20208555, 20551837, 23193950, 23616623, 23955454, 26907630, 26914337, 27323395, 27548616, 27967241, 2851073, 28851445, 29165008, 30539529, 30632623, 30632631, 31247675, 7579412, 7687860, 8217792, 8487587, 9052378, 9269784, 9479874, 9695958		★☆☆☆☆ Found in Text Mining only
Leukemia, Myelocytic, Acute	Leukemia	LHGDN	18333845		★☆☆☆☆ Found in Text Mining only
Leukocyte adhesion deficiency type 1	Leukocyte adhesion deficiency	Pubtator	31201998, 34012442, 35154479, 35167655	Associate	★☆☆☆☆ Found in Text Mining only
Leukocyte adhesion deficiency type 1	Leukocyte adhesion deficiency	Pubtator	33362794	Stimulate	★☆☆☆☆ Found in Text Mining only
Leukocyte adhesion deficiency type 1	Leukocyte adhesion deficiency	Pubtator	34122428	Inhibit	★☆☆☆☆ Found in Text Mining only
Leukopenia	Leukopenia	BEFREE	29447988		★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	30404730, 30808634		★☆☆☆☆ Found in Text Mining only
Liver Cirrhosis	Liver cirrhosis	Pubtator	33230233	Associate	★☆☆☆☆ Found in Text Mining only
Liver Cirrhosis Biliary	Liver cirrhosis	Pubtator	25627620, 27631617, 32724082	Associate	★☆☆☆☆ Found in Text Mining only
Lung Diseases Interstitial	Lung disease	Pubtator	37898737	Associate	★☆☆☆☆ Found in Text Mining only
Lung Diseases, Interstitial	Lung Diseases	BEFREE	21484765		★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung neoplasms	Pubtator	29129073, 30452447	Associate	★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus	Lupus Erythematosus	BEFREE	18650480, 30842314		★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus Discoid	Discoid lupus erythematosus	Pubtator	35594909	Associate	★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus Systemic	Systemic lupus erythematosus	Pubtator	11067960, 11302879, 15547095, 21250838, 21961021, 23821660, 23913957, 27172182, 27424138, 29515028, 31085070, 31231380, 32082002, 34079550, 35130317, 39684227, 39711368	Associate	★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus Systemic	Systemic lupus erythematosus	Pubtator	15188368, 8403494	Inhibit	★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus Systemic	Systemic lupus erythematosus	Pubtator	19759858, 25210799, 33777025	Stimulate	★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus, Discoid	Lupus Erythematosus	BEFREE	18650480, 30842314		★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus, Systemic	Lupus Erythematosus	BEFREE	10444363, 10643707, 11067960, 11714391, 12215898, 12493014, 15547095, 15593213, 16755657, 16782556, 17608810, 18650480, 19774453, 22613599, 23821660, 24509687, 24790152, 25210799, 29233832, 29515028, 30502542, 30842314, 31165780, 9710436		★☆☆☆☆ Found in Text Mining only
Lupus Nephritis	Lupus Nephritis	BEFREE	20974656		★☆☆☆☆ Found in Text Mining only
Lupus Nephritis	Lupus nephritis	Pubtator	36834923	Associate	★☆☆☆☆ Found in Text Mining only
Lupus Vulgaris	Lupus Vulgaris	BEFREE	18650480, 30842314		★☆☆☆☆ Found in Text Mining only
Lymphocytosis	Lymphocytosis	BEFREE	21626106, 9369429		★☆☆☆☆ Found in Text Mining only
Lymphoid leukemia	Lymphoid leukemia	BEFREE	1696310, 17046711, 19143872, 24698102, 28888074, 30539476, 30714847		★☆☆☆☆ Found in Text Mining only
Lymphoma	Lymphoma	Pubtator	10192425, 10706880, 11849235, 15001473, 17827849, 18227839, 20304086, 20668228, 23341189, 2450350, 25318949, 31142587, 32592454, 34587238, 35049413, 35294040, 35857488, 35917442, 35990518, 36096643, 36153593, 37757633, 37976456, 7517719	Associate	★☆☆☆☆ Found in Text Mining only
Lymphoma	Lymphoma	BEFREE	10878363, 10969772, 15507526, 16430470, 17046711, 17083975, 17339188, 18227839, 18829563, 19025415, 19719389, 20387166, 20631379, 21878902, 22546857, 22826319, 23090078, 23546520, 2361698, 24365143, 24938766, 26065479, 26188068, 27479233, 27491640, 27913506, 28067900, 28291388, 28456379, 28484276, 28725044, 28762313, 28765140, 29107016, 29207878, 29358181, 29367945, 29544528, 29620951, 29641322, 29669863, 29678657, 29685162, 29909914, 29922424, 30097433, 30156435, 30198955, 30261221, 30300581, 30413825, 30524895, 30611570, 30622115, 30680777, 30764841, 30809033, 30828333, 30841880, 30942469, 31198178, 31372000, 31429760, 31439577, 31446199, 31482064, 31611950, 31690821, 31847470, 7492789, 8698315, 9566763		★☆☆☆☆ Found in Text Mining only
Lymphoma	Lymphoma	Pubtator	25612555	Stimulate	★☆☆☆☆ Found in Text Mining only
Lymphoma	Lymphoma	HPO_DG			★☆☆☆☆ Found in Text Mining only
Lymphoma Follicular	Lymphoma	Pubtator	14681948, 19382196, 20927367, 36314855, 36532014, 7514436	Associate	★☆☆☆☆ Found in Text Mining only
Lymphoma Follicular	Lymphoma	Pubtator	15624204	Inhibit	★☆☆☆☆ Found in Text Mining only
Lymphoma, Follicular	Lymphoma	BEFREE	11168517, 1380203, 14681948, 19787231, 20927367, 29226764, 29909914, 31648294, 9160682		★☆☆☆☆ Found in Text Mining only
Lymphoma, Large-Cell, Follicular	Lymphoma	BEFREE	29895668, 30394400, 30652353, 30769193, 30782611, 30919158, 30942469, 31446199		★☆☆☆☆ Found in Text Mining only
Lymphoma, Non-Hodgkin	Non-Hodgkin lymphoma	BEFREE	12077238, 15842655, 19147785, 22421972, 2540603, 27479233, 29032264, 29895668, 30394400, 30652353, 30769193, 30782611, 30808634, 30919158, 30942469, 31005597, 31090657, 31110096, 31242389, 31428935, 31446199, 31772298		★☆☆☆☆ Found in Text Mining only
Lymphoma, Non-Hodgkin, Familial	Lymphoma	BEFREE	12077238, 22421972, 2540603, 29032264, 29895668, 30394400, 30652353, 30769193, 30782611, 30808634, 30919158, 30942469, 31005597, 31090657, 31242389, 31446199, 31772298		★☆☆☆☆ Found in Text Mining only
Lymphopenia	Lymphopenia	BEFREE	23553769, 24750412, 30782088, 31748640		★☆☆☆☆ Found in Text Mining only
Lymphopenia	Lymphopenia	HPO_DG			★☆☆☆☆ Found in Text Mining only
Lymphoproliferative Disorders	Lymphoproliferative Disorder	BEFREE	16430470		★☆☆☆☆ Found in Text Mining only
Macular dystrophy, corneal type 1	Macular corneal dystrophy	BEFREE	9432023		★☆☆☆☆ Found in Text Mining only
Malignant Childhood Neoplasm	Malignant Neoplasm	BEFREE	21323891		★☆☆☆☆ Found in Text Mining only
Malignant lymphoma, lymphocytic, intermediate differentiation, diffuse	Malignant lymphoma, lymphocytic, intermediate differentiation	BEFREE	12801841, 31110096, 31534006		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of liver	Liver Cancer	BEFREE	29861325		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of lung	Lung Cancer	BEFREE	30851071		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of stomach	Stomach Neoplasms	BEFREE	28419993		★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	12611072, 14961035, 16217038, 16932339, 18227839, 19001137, 19109559, 19638468, 19905893, 19965644, 20428207, 20631379, 21174490, 21323891, 21487038, 21540550, 21551245, 21832238, 21878902, 22107246, 22458956, 23090078, 23377665, 23469246, 23546520, 23872144, 23885836, 24030379, 24261468, 24329789, 24365143, 24667955, 24782509, 24888271, 25414443, 25427612, 25510272, 25621840, 25640460, 25686832, 25721896, 25753571, 25838392, 26030772, 26099639, 26115358, 26560054, 26574400, 26907630, 26953076, 27009942, 27021308, 27040708, 27084741, 27207800, 27207802, 27226436, 27255991, 27329987, 27475429, 27518241, 27526682, 27530312, 27546707, 27548616, 27598971, 27663593, 27789538, 27887866, 28025978, 28025979, 28053197, 28059624, 28067900, 28110394, 28143567, 28187946, 28202953, 28330372, 28345004, 28357916, 28410137, 28456379, 28466386, 28497159, 28506444, 28541315, 28543380, 28641074, 28716155, 28754600, 28762313, 28764981, 28771104, 28771105, 28807568, 28821531, 28851445, 28903943, 28924019, 29024301, 29025771, 29038338, 29058502, 29118005, 29147628, 29157295, 29163850, 29165008, 29207878, 29261129, 29298756, 29315094, 29316610, 29329591, 29334771, 29377003, 29481659, 29497427, 29499327, 29499750, 29605760, 29676233, 29771253, 29808005, 29859774, 29909912, 29928472, 30031396, 30261221, 30275435, 30288790, 30296188, 30309819, 30315238, 30362586, 30380973, 30387077, 30415658, 30444200, 30463359, 30479831, 30539476, 30563981, 30586620, 30611570, 30623002, 30632631, 30636882, 30685216, 30729531, 30784102, 30826931, 30878123, 30880819, 30941303, 31004624, 31012549, 31064990, 31160157, 31160723, 31182380, 31195686, 31289581, 31300451, 31314617, 31372000, 31419568, 31431708, 31431714, 31502163, 31554741, 31577606, 31586401, 31605820, 31619548, 31634527, 31638599, 31658644, 31662326, 31712432, 31743392, 31779130, 9058731		★☆☆☆☆ Found in Text Mining only
Mantle cell lymphoma	Mantle Cell Lymphoma	BEFREE	12801841, 14633913, 15272540, 15946316, 21599592, 23620405, 25120048, 27998273, 31110096, 31534006		★☆☆☆☆ Found in Text Mining only
Marginal Zone B-Cell Lymphoma	B-Cell Lymphoma	BEFREE	28857075		★☆☆☆☆ Found in Text Mining only
Mediastinal (Thymic) Large B-Cell Lymphoma	B-Cell Lymphoma	BEFREE	28732145		★☆☆☆☆ Found in Text Mining only
melanoma	Melanoma	BEFREE	24329789, 28497159		★☆☆☆☆ Found in Text Mining only
Melanoma	Melanoma	Pubtator	33488585, 38307835	Associate	★☆☆☆☆ Found in Text Mining only
Monoclonal B-Cell Lymphocytosis	B-Cell Lymphocytosis	BEFREE	19213679, 20595513		★☆☆☆☆ Found in Text Mining only
Monoclonal Gammopathy of Undetermined Significance	Monoclonal Gammapathies	BEFREE	15334545, 1830500, 29316245, 9264387		★☆☆☆☆ Found in Text Mining only
Mosaic variegated aneuploidy syndrome 1	Mosaic Variegated Aneuploidy	BEFREE	31053147		★☆☆☆☆ Found in Text Mining only
Mucocutaneous Lymph Node Syndrome	Kawasaki disease	Pubtator	33622252	Associate	★☆☆☆☆ Found in Text Mining only
Mucosa-Associated Lymphoid Tissue Lymphoma	Mucosa-associated lymphoma	BEFREE	12108676, 28421369, 28857075		★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Multiple myeloma	BEFREE	10201980, 10552966, 10690543, 10911386, 11698282, 12148889, 12393520, 1375109, 14531906, 15068900, 15739024, 16430470, 1830500, 21454202, 22333880, 23770975, 24195508, 25015938, 25049282, 25185784, 25578543, 25793710, 26953076, 28233151, 28928126, 29165008, 29316245, 29669947, 30559740, 31378662, 7498362, 8634446, 8639790, 9057669, 9649209		★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Multiple myeloma	Pubtator	10233390, 10460621, 10552966, 10911386, 11110713, 11823041, 12060120, 23019187, 23818359, 26352815, 27479184, 29316245, 31182688, 31316055, 35417527, 38035078, 7522634, 7529064, 8490175, 8639790, 9057669, 9207470	Associate	★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Multiple myeloma	Pubtator	25277787	Stimulate	★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Multiple myeloma	Pubtator	9450807, 9649209	Inhibit	★☆☆☆☆ Found in Text Mining only
Multiple Sclerosis	Multiple Sclerosis	BEFREE	12928426, 15210828, 24092328, 27412504, 27925187, 28777826		★☆☆☆☆ Found in Text Mining only
Multiple Sclerosis	Multiple sclerosis	Pubtator	30479356, 31004050, 34124274, 34394078, 35197967, 36640058, 39317145	Associate	★☆☆☆☆ Found in Text Mining only
Multiple Sclerosis, Relapsing-Remitting	Multiple Sclerosis	BEFREE	30408481		★☆☆☆☆ Found in Text Mining only
Muscular Atrophy Spinal	Spinal muscular atrophy	Pubtator	30102724	Associate	★☆☆☆☆ Found in Text Mining only
Myasthenia Gravis	Myasthenia Gravis	BEFREE	31555344		★☆☆☆☆ Found in Text Mining only
Myasthenia Gravis	Myasthenia gravis	Pubtator	35978310	Associate	★☆☆☆☆ Found in Text Mining only
MYELODYSPLASTIC SYNDROME	Myelodysplastic Syndrome	BEFREE	21635204		★☆☆☆☆ Found in Text Mining only
Myelodysplastic Syndromes	Myelodysplastic syndrome	Pubtator	20647647	Inhibit	★☆☆☆☆ Found in Text Mining only
Myelodysplastic Syndromes	Myelodysplastic syndrome	Pubtator	21635204, 33369070, 7528567	Associate	★☆☆☆☆ Found in Text Mining only
Myeloid Leukemia	Myeloid Leukemia	BEFREE	11426630		★☆☆☆☆ Found in Text Mining only
Myeloid Leukemia, Chronic	Myeloid Leukemia	BEFREE	12801841, 1907927, 8111739		★☆☆☆☆ Found in Text Mining only
Myocarditis	Myocarditis	Pubtator	27553592	Associate	★☆☆☆☆ Found in Text Mining only
Myositis	Myositis	Pubtator	35371068	Associate	★☆☆☆☆ Found in Text Mining only
Myotonic Dystrophy	Myotonic dystrophy	Pubtator	27469170	Stimulate	★☆☆☆☆ Found in Text Mining only
Myotonic Dystrophy	Myotonic dystrophy	Pubtator	34830017	Associate	★☆☆☆☆ Found in Text Mining only
MYOTONIC DYSTROPHY 1	Myotonic dystrophy	BEFREE	16437243		★☆☆☆☆ Found in Text Mining only
Nasal Polyps	Nasal polyp	Pubtator	20515572, 25469646	Associate	★☆☆☆☆ Found in Text Mining only
Nasal Polyps	Nasal polyposis	BEFREE	25469646, 27163839		★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	10512714, 11426565, 15507526, 15654349, 15842655, 16393685, 16430470, 17083975, 17855649, 18519787, 18829563, 1884024, 19638468, 20307317, 20511669, 21487038, 21599592, 2210691, 22421972, 22546857, 22797699, 23295945, 23469246, 23872144, 24329789, 24782509, 25683635, 25753571, 26065479, 26183927, 26516065, 27189167, 27255991, 27258611, 27598655, 27744645, 27789538, 28306193, 28456379, 28484276, 28551388, 28576927, 29433552, 29641322, 29772559, 29912725, 29928472, 30288343, 30362586, 30479831, 30501490, 30890066, 30915277, 31110096, 31189721, 31444250, 31487876, 7669664, 8427968, 8698315, 9058731		★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	HPO_DG			★☆☆☆☆ Found in Text Mining only
Nephrotic Syndrome	Nephrotic syndrome	Pubtator	31352232	Associate	★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	BEFREE	22589486, 31849984		★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	Pubtator	22589486, 28687069, 9009220	Associate	★☆☆☆☆ Found in Text Mining only
Neurofibromatosis 1	Neurofibromatosis	BEFREE	20307317		★☆☆☆☆ Found in Text Mining only
Neuromyelitis Optica	Neuromyelitis Optica	BEFREE	25293807, 28017256, 29593838, 31495497		★☆☆☆☆ Found in Text Mining only
Neutropenia	Neutropenia	BEFREE	29447988		★☆☆☆☆ Found in Text Mining only
Non-Small Cell Lung Carcinoma	Lung carcinoma	BEFREE	22608141		★☆☆☆☆ Found in Text Mining only
Noninfiltrating Intraductal Carcinoma	Ductal carcinoma	BEFREE	28326600		★☆☆☆☆ Found in Text Mining only
Nonketotic Hyperglycinemia	Nonketotic Hyperglycinemia	BEFREE	2013671		★☆☆☆☆ Found in Text Mining only
Optic Neuritis	Optic Neuritis	BEFREE	15236406, 25593026		★☆☆☆☆ Found in Text Mining only
Optic Neuritis	Optic neuritis	Pubtator	31601977	Associate	★☆☆☆☆ Found in Text Mining only
Osteoarthritis	Osteoarthritis	Pubtator	21953087, 32245507	Associate	★☆☆☆☆ Found in Text Mining only
Ovarian Diseases	Ovarian diseases	Pubtator	34764108	Associate	★☆☆☆☆ Found in Text Mining only
Ovarian Failure, Premature	Ovarian Failure	BEFREE	29181820		★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Ovarian neoplasm	Pubtator	37221403, 38307835	Associate	★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasms	Pancreatic neoplasm	Pubtator	1976638	Associate	★☆☆☆☆ Found in Text Mining only
Pancreatitis	Pancreatitis	BEFREE	27085321		★☆☆☆☆ Found in Text Mining only
Pancytopenia	Pancytopenia	Pubtator	32455141	Associate	★☆☆☆☆ Found in Text Mining only
Papilloma	Papilloma	BEFREE	10894276		★☆☆☆☆ Found in Text Mining only
Parkinson Disease	Parkinson disease	Pubtator	25644063	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Parkinson Disease	Parkinson disease	BEFREE	28791571, 30871733		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Pemphigoid Bullous	Bullous pemphigoid	Pubtator	29335495	Stimulate	★☆☆☆☆ Found in Text Mining only
Pemphigus Foliaceus	Pemphigus Foliaceus	BEFREE	19421221		★☆☆☆☆ Found in Text Mining only
Periodontal Diseases	Periodontal Diseases	BEFREE	9495611		★☆☆☆☆ Found in Text Mining only
Periodontitis	Periodontitis	Pubtator	34859622	Associate	★☆☆☆☆ Found in Text Mining only
Peritoneal Neoplasms	Peritoneal neoplasm	Pubtator	36119051	Associate	★☆☆☆☆ Found in Text Mining only
Peritonitis	Peritonitis	Pubtator	36119051	Stimulate	★☆☆☆☆ Found in Text Mining only
Polyglandular Type I Autoimmune Syndrome	Polyglandular autoimmune syndrome	BEFREE	15751604		★☆☆☆☆ Found in Text Mining only
Pre B-cell acute lymphoblastic leukemia	B-cell Lymphoma	BEFREE	12791662, 1373967, 1375531, 15170892, 25640460, 27018867, 29155426, 29167392, 29948928, 30837712, 31749131		★☆☆☆☆ Found in Text Mining only
Precursor B-cell lymphoblastic leukemia	Lymphoblastic Leukemia	BEFREE	10588740, 11001880, 11279625, 11494125, 12791662, 1373967, 1375841, 1465029, 15170892, 1531305, 16551973, 18704194, 18829563, 20110422, 20231472, 21474181, 23491079, 23585892, 24311149, 24319203, 24698102, 25313995, 25640460, 25793710, 26574400, 26907630, 26914337, 27018867, 27253354, 2732004, 27354412, 27841776, 28110394, 28257957, 28441264, 28466386, 28583018, 29024301, 29050700, 29065420, 29118234, 29163850, 29178361, 29385370, 29385376, 29433552, 29451276, 29458388, 29481659, 2959808, 29755706, 29895435, 29910179, 30089630, 30104252, 30190371, 30198955, 30576834, 30632623, 30695783, 30728140, 30784101, 30826931, 30973486, 30979721, 31055613, 31092900, 31182121, 31201998, 31321805, 31451445, 31650176, 31690821, 31738832, 31793170, 31815579, 31824840, 7686033, 7949140, 8412330, 9446655		★☆☆☆☆ Found in Text Mining only
Precursor B-Cell Lymphoblastic Leukemia-Lymphoma	Lymphoblastic Leukemia	BEFREE	11279625, 1373967, 1375841, 17107913, 18704194, 27607436, 2959808, 30695783, 7686033, 7949140, 8182949, 9479874		★☆☆☆☆ Found in Text Mining only
Precursor Cell Lymphoblastic Leukemia Lymphoma	Lymphoblastic Leukemia	BEFREE	1696310, 17107913, 17855649, 19143872, 19238016, 23193950, 25675873, 27009300, 27744645, 27855281, 28039267, 28286501, 28291388, 28698205, 28888074, 29017060, 29018147, 29143249, 29385376, 29490423, 29743179, 29766234, 29789639, 29847570, 29895435, 30046149, 30187944, 30206753, 30221037, 30539476, 30680780, 30714847, 30808634, 30915277, 31090657, 31195686, 31242389, 31281894, 31282760, 31465532, 31541890, 31622496, 31798590, 31837735, 9050885		★☆☆☆☆ Found in Text Mining only
Precursor T-Cell Lymphoblastic Leukemia-Lymphoma	Lymphoblastic Leukemia	BEFREE	2542699, 8618442, 9479874		★☆☆☆☆ Found in Text Mining only
Premature Menopause	Premature Menopause	BEFREE	29181820		★☆☆☆☆ Found in Text Mining only
Primary biliary cirrhosis	Biliary Cirrhosis	BEFREE	21092071, 26429926, 27784538		★☆☆☆☆ Found in Text Mining only
Primary central nervous system lymphoma	Central Nervous System Lymphoma	BEFREE	31712432		★☆☆☆☆ Found in Text Mining only
Primary Ciliary Dyskinesia	Ciliary dyskinesia	BEFREE	24462038		★☆☆☆☆ Found in Text Mining only
Primary immune deficiency disorder	immunodeficiency	BEFREE	26187864		★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	33402974	Associate	★☆☆☆☆ Found in Text Mining only
Psoriasis	Psoriasis	BEFREE	28461105		★☆☆☆☆ Found in Text Mining only
Psoriasis vulgaris	Psoriasis vulgaris	BEFREE	30341229		★☆☆☆☆ Found in Text Mining only
Pulmonary Disease Chronic Obstructive	Chronic obstructive pulmonary disease	Pubtator	33535173	Associate	★☆☆☆☆ Found in Text Mining only
Purpura, Thrombotic Thrombocytopenic	Thrombotic thrombocytopenic purpura	BEFREE	25339550		★☆☆☆☆ Found in Text Mining only
Recurrent bronchitis	Bronchitis	HPO_DG			★☆☆☆☆ Found in Text Mining only
Recurrent otitis media	Otitis media	HPO_DG			★☆☆☆☆ Found in Text Mining only
Recurrent sinusitis	Sinusitis	HPO_DG			★☆☆☆☆ Found in Text Mining only
Renal Cell Carcinoma	Renal Carcinoma	BEFREE	27812180		★☆☆☆☆ Found in Text Mining only
Respiratory Failure	Respiratory Failure	BEFREE	29808005		★☆☆☆☆ Found in Text Mining only
Rheumatic Fever	Rheumatic fever	Pubtator	15013984	Associate	★☆☆☆☆ Found in Text Mining only
Rheumatoid Arthritis	Rheumatoid arthritis	BEFREE	12106500, 12215898, 22962438, 23490466, 23696745, 27434862, 8838506		★☆☆☆☆ Found in Text Mining only
Rhinitis Allergic	Rhinitis	Pubtator	31598989	Associate	★☆☆☆☆ Found in Text Mining only
Rufous oculocutaneous albinism	Rufous oculocutaneous albinism	Pubtator	9207470	Inhibit	★☆☆☆☆ Found in Text Mining only
Sarcoidosis	Sarcoidosis	Pubtator	21653741	Associate	★☆☆☆☆ Found in Text Mining only
Schizophrenia	Schizophrenia	BEFREE	28704576		★☆☆☆☆ Found in Text Mining only
Scleroderma Systemic	Systemic sclerosis	Pubtator	15188368	Associate	★☆☆☆☆ Found in Text Mining only
Selective immunoglobulin A deficiency	Selective Immunoglobulin A Deficiency	BEFREE	19738033		★☆☆☆☆ Found in Text Mining only
Septicemia	Septicemia	BEFREE	30114952, 31140990, 31644352		★☆☆☆☆ Found in Text Mining only
Severe Combined Immunodeficiency	Severe combined immunodeficiency disease	BEFREE	10552966, 1370213, 1373967, 1375841, 7678881, 9058731		★☆☆☆☆ Found in Text Mining only
Sjogren's Syndrome	Sjogren syndrome	Pubtator	16385503, 21128999, 26884645, 29453859, 29655283, 30589451, 34367157	Associate	★☆☆☆☆ Found in Text Mining only
Sjogren's Syndrome	Sjogren syndrome	Pubtator	33777025	Stimulate	★☆☆☆☆ Found in Text Mining only
Sleep Apnea, Obstructive	Sleep Apnea	BEFREE	30015400		★☆☆☆☆ Found in Text Mining only
Split hand foot deformity 1	Split hand foot deformity	BEFREE	31242389		★☆☆☆☆ Found in Text Mining only
Spondylitis Ankylosing	Ankylosing spondylitis	Pubtator	35420296	Associate	★☆☆☆☆ Found in Text Mining only
Squamous Cell Carcinoma of Head and Neck	Squamous cell carcinoma	Pubtator	32831060, 33529452, 36157879, 36284268	Associate	★☆☆☆☆ Found in Text Mining only
Stomach Carcinoma	Stomach Carcinoma	BEFREE	28419993		★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	26378021, 38259671	Associate	★☆☆☆☆ Found in Text Mining only
Stroke	Stroke	Pubtator	30760287	Associate	★☆☆☆☆ Found in Text Mining only
Systemic Scleroderma	Scleroderma	BEFREE	15277237, 15593213, 17493148, 20175836, 21961844, 26782005, 29076114		★☆☆☆☆ Found in Text Mining only
Systemic Scleroderma	Scleroderma	LHGDN	15593213		★☆☆☆☆ Found in Text Mining only
T-Cell Lymphoma	T-Cell Lymphoma	BEFREE	30553467		★☆☆☆☆ Found in Text Mining only
Tetany	Tetany	Pubtator	26271191	Associate	★☆☆☆☆ Found in Text Mining only
Thrombocytopenia	Thrombocytopenia	Pubtator	11823041	Associate	★☆☆☆☆ Found in Text Mining only
Thymoma	Thymoma	BEFREE	29088744		★☆☆☆☆ Found in Text Mining only
Thyroid associated opthalmopathies	Thyroid eye disease	BEFREE	28660988		★☆☆☆☆ Found in Text Mining only
Thyroiditis Autoimmune	Thyroiditis	Pubtator	31790305	Inhibit	★☆☆☆☆ Found in Text Mining only
Tourette Syndrome	Tourette syndrome	Pubtator	15013984	Associate	★☆☆☆☆ Found in Text Mining only
TUBEROUS SCLEROSIS 1 (disorder)	Tuberous Sclerosis	BEFREE	30408629		★☆☆☆☆ Found in Text Mining only
Ulcerative Colitis	Ulcerative colitis	BEFREE	19664152		★☆☆☆☆ Found in Text Mining only
Urinary Bladder Neoplasms	Urinary bladder neoplasms	Pubtator	34296545, 9223755	Associate	★☆☆☆☆ Found in Text Mining only
Uterine Cervical Neoplasms	Uterine neoplasm	Pubtator	31316301, 38084896	Associate	★☆☆☆☆ Found in Text Mining only
Vasculitis	Vasculitis	HPO_DG			★☆☆☆☆ Found in Text Mining only
Vesicular Stomatitis	Vesicular Stomatitis	BEFREE	30104252		★☆☆☆☆ Found in Text Mining only
Vitamin D Deficiency	Vitamin D Deficiency	BEFREE	28367920		★☆☆☆☆ Found in Text Mining only
Waldenstrom Macroglobulinemia	Waldenstrom`s Macroglobulinemia	BEFREE	18981296, 19074725, 22010211, 23477935, 27329639, 30190025, 30227405		★☆☆☆☆ Found in Text Mining only
Waldenstrom Macroglobulinemia	Waldenstrom macroglobulinemia	Pubtator	18981296, 25853860, 30198568, 36332058	Associate	★☆☆☆☆ Found in Text Mining only
Wiskott-Aldrich Syndrome	Wiskott-Aldrich Syndrome	BEFREE	27330000, 28859032		★☆☆☆☆ Found in Text Mining only
X-linked agammaglobulinemia	Agammaglobulinemia, X-Linked	BEFREE	1849806, 18708023, 19419768, 7705412		★☆☆☆☆ Found in Text Mining only