GPR52 (G protein-coupled receptor 52)

Gene

• Entrez ID: 9293
• Gene name: G protein-coupled receptor 52
• Gene symbol: GPR52
• Synonyms (NCBI Gene): -
• Chromosome: 1
• Chromosome location: 1q25.1
• Summary: Members of the G protein-coupled receptor (GPR) family play important roles in signal transduction from the external environment to the inside of the cell.[supplied by OMIM, Jul 2002]

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT1031506	hsa-miR-548aa	CLIP-seq
MIRT1031507	hsa-miR-640	CLIP-seq
MIRT2005981	hsa-miR-4659a-3p	CLIP-seq
MIRT2005982	hsa-miR-4659b-3p	CLIP-seq

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0004930	Function	G protein-coupled receptor activity	IDA	24587241
GO:0004930	Function	G protein-coupled receptor activity	IEA
GO:0004930	Function	G protein-coupled receptor activity	TAS	9931487
GO:0005515	Function	Protein binding	IPI	32814053
GO:0005886	Component	Plasma membrane	IBA
GO:0005886	Component	Plasma membrane	IEA
GO:0005886	Component	Plasma membrane	TAS	9931487
GO:0007165	Process	Signal transduction	IEA
GO:0007186	Process	G protein-coupled receptor signaling pathway	IBA
GO:0007186	Process	G protein-coupled receptor signaling pathway	IEA
GO:0007186	Process	G protein-coupled receptor signaling pathway	TAS	9931487
GO:0007602	Process	Phototransduction	IBA
GO:0007626	Process	Locomotory behavior	IEA
GO:0007626	Process	Locomotory behavior	ISS
GO:0008020	Function	G protein-coupled photoreceptor activity	IBA
GO:0009410	Process	Response to xenobiotic stimulus	IDA	24587241
GO:0009584	Process	Detection of visible light	IEA
GO:0016020	Component	Membrane	IEA
GO:0071482	Process	Cellular response to light stimulus	IBA

Other IDs

• MIM: 604106
• HGNC: 4508
• e!Ensembl: ENSG00000203737

Protein

• UniProt ID: Q9Y2T5
• Protein name: G-protein coupled receptor 52
• Protein function: Gs-coupled receptor activated by antipsychotics reserpine leading to an increase in intracellular cAMP and its internalization (PubMed:24587241). May play a role in locomotor activity through modulation of dopamine, NMDA and ADORA2A-induced loco
• PDB: 6LI0, 6LI1, 6LI2, 6LI3, 8HMP
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00001	7tm_1	57 → 317	7 transmembrane receptor (rhodopsin family)	Family

• Tissue specificity: TISSUE SPECIFICITY: Expressed in brain, especially in striatum. {ECO:0000269|PubMed:24587241}.
• Sequence:

  MNESRWTEWRILNMSSGIVNVSERHSCPLGFGHYSVVDVCIFETVVIVLLTFLIIAGNLT
  VIFVFHCAPLLHHYTTSYFIQTMAYADLFVGVSCLVPTLSLLHYSTGVHESLTCQVFGYI
  ISVLKSVSMACLACISVDRYLAITKPLSYNQLVTPCRLRICIILIWIYSCLIFLPSFFGW
  GKPGYHGDIFEWCATSWLTSAYFTGFIVCLLYAPAAFVVCFTYFHIFKICRQHTKEINDR
  RARFPSHEVDSSRETGHSPDRRYAMVLFRITSVFYMLWLPYIIYFLLESSRVLDNPTLSF
  LTTWLAISNSFCNCVIYSLSNSVFRLGLRRLSETMCTSCMCVKDQEAQEPKPRKRANSCS
  I

• Sequence length: 361

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
NONORGANIC PSYCHOSIS	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PSYCHIATRIC DISORDER	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PSYCHOTIC DISORDERS	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Congenital anomaly of brain	Brain malformation	BEFREE	26680650		★☆☆☆☆ Found in Text Mining only
Huntington Disease	Huntington Disease	BEFREE	25738228, 29608652		★☆☆☆☆ Found in Text Mining only
Intellectual Disability	Mental retardation	BEFREE	26680650		★☆☆☆☆ Found in Text Mining only
Mental disorders	Mental Disorders	BEFREE	24587241, 28433511		★☆☆☆☆ Found in Text Mining only
Nonorganic psychosis	Nonorganic Psychosis	PSYGENET_DG	24587241		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Psychotic Disorders	Psychosis	PSYGENET_DG	24587241		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Psychotic Disorders	Psychosis	BEFREE	29478803		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Schizophrenia	Schizophrenia	BEFREE	28583861, 28851764		★☆☆☆☆ Found in Text Mining only