GPR55 (G protein-coupled receptor 55)

Gene

• Entrez ID: 9290
• Gene name: G protein-coupled receptor 55
• Gene symbol: GPR55
• Synonyms (NCBI Gene): LPIR1
• Chromosome: 2
• Chromosome location: 2q37.1
• Summary: This gene belongs to the G-protein-coupled receptor superfamily. The encoded integral membrane protein is a likely cannabinoid receptor. It may be involved in several physiological and pathological processes by activating a variety of signal transduction

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT051125	hsa-miR-16-5p	CLASH	23622248
MIRT040844	hsa-miR-18a-3p	CLASH	23622248
MIRT040546	hsa-miR-92b-3p	CLASH	23622248
MIRT713265	hsa-miR-3620-3p	HITS-CLIP	19536157
MIRT713264	hsa-miR-4691-3p	HITS-CLIP	19536157
MIRT713263	hsa-miR-4286	HITS-CLIP	19536157
MIRT713262	hsa-miR-3157-5p	HITS-CLIP	19536157
MIRT713261	hsa-miR-2355-5p	HITS-CLIP	19536157
MIRT618470	hsa-miR-6887-3p	HITS-CLIP	23824327
MIRT618469	hsa-miR-6795-3p	HITS-CLIP	23824327
MIRT644690	hsa-miR-660-3p	HITS-CLIP	23824327
MIRT644689	hsa-miR-6787-3p	HITS-CLIP	23824327
MIRT618466	hsa-miR-1236-3p	HITS-CLIP	23824327
MIRT618465	hsa-miR-24-3p	HITS-CLIP	23824327
MIRT618464	hsa-miR-6826-3p	HITS-CLIP	23824327
MIRT644688	hsa-miR-6749-3p	HITS-CLIP	23824327
MIRT618460	hsa-miR-1238-3p	HITS-CLIP	23824327
MIRT618470	hsa-miR-6887-3p	HITS-CLIP	23824327
MIRT618469	hsa-miR-6795-3p	HITS-CLIP	23824327
MIRT618468	hsa-miR-4667-3p	HITS-CLIP	23824327
MIRT618467	hsa-miR-877-3p	HITS-CLIP	23824327
MIRT618466	hsa-miR-1236-3p	HITS-CLIP	23824327
MIRT618465	hsa-miR-24-3p	HITS-CLIP	23824327
MIRT618464	hsa-miR-6826-3p	HITS-CLIP	23824327
MIRT618463	hsa-miR-6780a-3p	HITS-CLIP	23824327
MIRT618462	hsa-miR-6881-3p	HITS-CLIP	23824327
MIRT618461	hsa-miR-670-3p	HITS-CLIP	23824327
MIRT618460	hsa-miR-1238-3p	HITS-CLIP	23824327
MIRT713265	hsa-miR-3620-3p	HITS-CLIP	19536157
MIRT713264	hsa-miR-4691-3p	HITS-CLIP	19536157
MIRT713263	hsa-miR-4286	HITS-CLIP	19536157
MIRT713262	hsa-miR-3157-5p	HITS-CLIP	19536157
MIRT713261	hsa-miR-2355-5p	HITS-CLIP	19536157
MIRT618470	hsa-miR-6887-3p	HITS-CLIP	23824327
MIRT618469	hsa-miR-6795-3p	HITS-CLIP	23824327
MIRT644690	hsa-miR-660-3p	HITS-CLIP	23824327
MIRT644689	hsa-miR-6787-3p	HITS-CLIP	23824327
MIRT618466	hsa-miR-1236-3p	HITS-CLIP	23824327
MIRT618465	hsa-miR-24-3p	HITS-CLIP	23824327
MIRT618464	hsa-miR-6826-3p	HITS-CLIP	23824327
MIRT644688	hsa-miR-6749-3p	HITS-CLIP	23824327
MIRT618460	hsa-miR-1238-3p	HITS-CLIP	23824327
MIRT618470	hsa-miR-6887-3p	HITS-CLIP	23824327
MIRT618469	hsa-miR-6795-3p	HITS-CLIP	23824327
MIRT618468	hsa-miR-4667-3p	HITS-CLIP	23824327
MIRT618467	hsa-miR-877-3p	HITS-CLIP	23824327
MIRT618466	hsa-miR-1236-3p	HITS-CLIP	23824327
MIRT618465	hsa-miR-24-3p	HITS-CLIP	23824327
MIRT618464	hsa-miR-6826-3p	HITS-CLIP	23824327
MIRT618463	hsa-miR-6780a-3p	HITS-CLIP	23824327
MIRT618462	hsa-miR-6881-3p	HITS-CLIP	23824327
MIRT618461	hsa-miR-670-3p	HITS-CLIP	23824327
MIRT618460	hsa-miR-1238-3p	HITS-CLIP	23824327
MIRT1031508	hsa-miR-1236	CLIP-seq
MIRT1031509	hsa-miR-1238	CLIP-seq
MIRT1031510	hsa-miR-1301	CLIP-seq
MIRT1031511	hsa-miR-1343	CLIP-seq
MIRT1031512	hsa-miR-3065-3p	CLIP-seq
MIRT1031513	hsa-miR-3140-3p	CLIP-seq
MIRT1031514	hsa-miR-3140-5p	CLIP-seq
MIRT1031515	hsa-miR-3617	CLIP-seq
MIRT1031516	hsa-miR-3620	CLIP-seq
MIRT1031517	hsa-miR-3684	CLIP-seq
MIRT1031518	hsa-miR-4660	CLIP-seq
MIRT1031519	hsa-miR-4691-5p	CLIP-seq
MIRT1031520	hsa-miR-5047	CLIP-seq
MIRT1031521	hsa-miR-600	CLIP-seq
MIRT1031522	hsa-miR-641	CLIP-seq
MIRT1549368	hsa-miR-296-5p	CLIP-seq
MIRT1549369	hsa-miR-4731-5p	CLIP-seq
MIRT1549370	hsa-miR-4758-3p	CLIP-seq
MIRT2005983	hsa-miR-1205	CLIP-seq
MIRT1031508	hsa-miR-1236	CLIP-seq
MIRT1031509	hsa-miR-1238	CLIP-seq
MIRT1031511	hsa-miR-1343	CLIP-seq
MIRT2005984	hsa-miR-3616-3p	CLIP-seq
MIRT2005985	hsa-miR-4436b-3p	CLIP-seq
MIRT1031518	hsa-miR-4660	CLIP-seq
MIRT1031519	hsa-miR-4691-5p	CLIP-seq
MIRT2005986	hsa-miR-498	CLIP-seq
MIRT2005987	hsa-miR-596	CLIP-seq
MIRT2005983	hsa-miR-1205	CLIP-seq
MIRT2238539	hsa-miR-3187-3p	CLIP-seq
MIRT2005984	hsa-miR-3616-3p	CLIP-seq
MIRT2238540	hsa-miR-3622a-3p	CLIP-seq
MIRT2238541	hsa-miR-3622b-3p	CLIP-seq
MIRT2238542	hsa-miR-3663-5p	CLIP-seq
MIRT2238543	hsa-miR-4276	CLIP-seq
MIRT2005985	hsa-miR-4436b-3p	CLIP-seq
MIRT2238544	hsa-miR-4527	CLIP-seq
MIRT2238545	hsa-miR-4529-5p	CLIP-seq
MIRT2238546	hsa-miR-4639-3p	CLIP-seq
MIRT1031518	hsa-miR-4660	CLIP-seq
MIRT1031519	hsa-miR-4691-5p	CLIP-seq
MIRT2238547	hsa-miR-4753-3p	CLIP-seq
MIRT2238548	hsa-miR-499-3p	CLIP-seq
MIRT2238549	hsa-miR-499a-3p	CLIP-seq
MIRT2005987	hsa-miR-596	CLIP-seq
MIRT2238550	hsa-miR-767-3p	CLIP-seq
MIRT1031508	hsa-miR-1236	CLIP-seq
MIRT1031509	hsa-miR-1238	CLIP-seq
MIRT2388668	hsa-miR-214	CLIP-seq
MIRT2388669	hsa-miR-3619-5p	CLIP-seq
MIRT2388670	hsa-miR-4530	CLIP-seq
MIRT1031519	hsa-miR-4691-5p	CLIP-seq
MIRT2388671	hsa-miR-634	CLIP-seq
MIRT2388672	hsa-miR-761	CLIP-seq
MIRT2450637	hsa-miR-1248	CLIP-seq
MIRT2450638	hsa-miR-128	CLIP-seq
MIRT2450639	hsa-miR-129-3p	CLIP-seq
MIRT1031510	hsa-miR-1301	CLIP-seq
MIRT2450640	hsa-miR-150	CLIP-seq
MIRT2450641	hsa-miR-197	CLIP-seq
MIRT1031512	hsa-miR-3065-3p	CLIP-seq
MIRT2450642	hsa-miR-3124-3p	CLIP-seq
MIRT1031515	hsa-miR-3617	CLIP-seq
MIRT2450643	hsa-miR-3667-3p	CLIP-seq
MIRT2450644	hsa-miR-3692	CLIP-seq
MIRT1031518	hsa-miR-4660	CLIP-seq
MIRT1031519	hsa-miR-4691-5p	CLIP-seq
MIRT1031520	hsa-miR-5047	CLIP-seq
MIRT1031521	hsa-miR-600	CLIP-seq
MIRT1031522	hsa-miR-641	CLIP-seq
MIRT1031510	hsa-miR-1301	CLIP-seq
MIRT1031512	hsa-miR-3065-3p	CLIP-seq
MIRT1031515	hsa-miR-3617	CLIP-seq
MIRT2450643	hsa-miR-3667-3p	CLIP-seq
MIRT1031518	hsa-miR-4660	CLIP-seq
MIRT1031519	hsa-miR-4691-5p	CLIP-seq
MIRT1031520	hsa-miR-5047	CLIP-seq
MIRT1031521	hsa-miR-600	CLIP-seq
MIRT1031522	hsa-miR-641	CLIP-seq
MIRT2238539	hsa-miR-3187-3p	CLIP-seq
MIRT2005984	hsa-miR-3616-3p	CLIP-seq
MIRT2005985	hsa-miR-4436b-3p	CLIP-seq
MIRT2238545	hsa-miR-4529-5p	CLIP-seq
MIRT2005987	hsa-miR-596	CLIP-seq
MIRT2238539	hsa-miR-3187-3p	CLIP-seq
MIRT2005984	hsa-miR-3616-3p	CLIP-seq
MIRT2005985	hsa-miR-4436b-3p	CLIP-seq
MIRT2238545	hsa-miR-4529-5p	CLIP-seq
MIRT2005987	hsa-miR-596	CLIP-seq

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0004930	Function	G protein-coupled receptor activity	IEA
GO:0004930	Function	G protein-coupled receptor activity	TAS	9931487
GO:0004949	Function	Cannabinoid receptor activity	IBA
GO:0004949	Function	Cannabinoid receptor activity	IDA	19723626
GO:0005886	Component	Plasma membrane	IBA
GO:0005886	Component	Plasma membrane	IDA	18757503
GO:0005886	Component	Plasma membrane	IEA
GO:0005886	Component	Plasma membrane	TAS	9931487
GO:0007165	Process	Signal transduction	IEA
GO:0007186	Process	G protein-coupled receptor signaling pathway	IBA
GO:0007186	Process	G protein-coupled receptor signaling pathway	IEA
GO:0007186	Process	G protein-coupled receptor signaling pathway	TAS	9931487
GO:0007200	Process	Phospholipase C-activating G protein-coupled receptor signaling pathway	IDA	18757503
GO:0016020	Component	Membrane	IEA
GO:0035025	Process	Positive regulation of Rho protein signal transduction	IDA	19805329
GO:0038171	Process	Cannabinoid signaling pathway	IEA
GO:0045453	Process	Bone resorption	IDA	19805329
GO:0045671	Process	Negative regulation of osteoclast differentiation	IDA	19805329
GO:0070374	Process	Positive regulation of ERK1 and ERK2 cascade	IDA	19805329

Other IDs

• MIM: 604107
• HGNC: 4511
• e!Ensembl: ENSG00000135898

Protein

• UniProt ID: Q9Y2T6
• Protein name: G-protein coupled receptor 55
• Protein function: G-protein coupled receptor that binds to several ligands including 2-arachidonoyl lysophosphatidylinositol or lysophosphatidylglucoside with high affinity, leading to rapid and transient activation of numerous intracellular signaling pathways (P
• PDB: 8ZX4, 8ZX5, 9GE2, 9GE3, 9IY8, 9IYA
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00001	7tm_1	37 → 288	7 transmembrane receptor (rhodopsin family)	Family

• Tissue specificity: TISSUE SPECIFICITY: Expressed in the caudate nucleus and putamen, but not detected in the hippocampus, thalamus, pons cerebellum, frontal cortex of the brain or in the liver. Expressed in osteoclasts and osteoblasts. Higly expressed in macrophages and B-c
• Sequence:

  MSQQNTSGDCLFDGVNELMKTLQFAVHIPTFVLGLLLNLLAIHGFSTFLKNRWPDYAATS
  IYMINLAVFDLLLVLSLPFKMVLSQVQSPFPSLCTLVECLYFVSMYGSVFTICFISMDRF
  LAIRYPLLVSHLRSPRKIFGICCTIWVLVWTGSIPIYSFHGKVEKYMCFHNMSDDTWSAK
  VFFPLEVFGFLLPMGIMGFCCSRSIHILLGRRDHTQDWVQQKACIYSIAASLAVFVVSFL
  PVHLGFFLQFLVRNSFIVECRAKQSISFFLQLSMCFSNVNCCLDVFCYYFVIKEFRMNIR
  AHRPSRVQLVLQDTTISRG

• Sequence length: 319

Pathways

Reactome:

Class A/1 (Rhodopsin-like receptors)
G alpha (i) signalling events

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
HYPERGLYCEMIA	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HYPERTRIGLYCERIDEMIA	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MAJOR DEPRESSIVE DISORDER	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Prostate cancer	Uncertain significance	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
ANOPHTHALMIA AND PULMONARY HYPOPLASIA	Syndromic microphthalmia	BEFREE	30061636		★☆☆☆☆ Found in Text Mining only
Anorexia Nervosa	Anorexia	BEFREE	20506567		★☆☆☆☆ Found in Text Mining only
Anxiety	Anxiety Disorder	BEFREE	28800762		★☆☆☆☆ Found in Text Mining only
Anxiety	Anxiety disorder	Pubtator	29435814	Associate	★☆☆☆☆ Found in Text Mining only
Anxiety Disorders	Anxiety Disorder	BEFREE	28800762		★☆☆☆☆ Found in Text Mining only
Arteriosclerosis	Arteriosclerosis	BEFREE	25970609		★☆☆☆☆ Found in Text Mining only
Arthritis, Psoriatic	Psoriatic Arthritis	BEFREE	30301214		★☆☆☆☆ Found in Text Mining only
Atherosclerosis	Atherosclerosis	BEFREE	25970609		★☆☆☆☆ Found in Text Mining only
Atherosclerosis	Atherosclerosis	Pubtator	25970609	Associate	★☆☆☆☆ Found in Text Mining only
Benign Neoplasm	Benign Neoplasm	CTD_human_DG	27423937		★☆☆☆☆ Found in Text Mining only
Bone Diseases	Bone disease	Pubtator	25970609	Associate	★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	29188802		★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	20590578, 27340777, 37688769	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	37688769	Associate	★☆☆☆☆ Found in Text Mining only
Cardiovascular Diseases	Cardiovascular Diseases	BEFREE	25970609		★☆☆☆☆ Found in Text Mining only
Cardiovascular Diseases	Cardiovascular disease	Pubtator	25970609	Associate	★☆☆☆☆ Found in Text Mining only
Cholangiocarcinoma	Cholangiocarcinoma	Pubtator	37688769	Associate	★☆☆☆☆ Found in Text Mining only
Colon Carcinoma	Colon Carcinoma	BEFREE	25533906		★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	28875496		★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	33959968, 35562947	Associate	★☆☆☆☆ Found in Text Mining only
Crohn Disease	Crohn Disease	BEFREE	28272905		★☆☆☆☆ Found in Text Mining only
Depressive disorder	Mental Depression	BEFREE	29435814		★☆☆☆☆ Found in Text Mining only
Depressive Disorder	Major depressive disorder	Pubtator	29435814	Associate	★☆☆☆☆ Found in Text Mining only
Diabetes	Diabetes	BEFREE	25545857, 27215467		★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes Mellitus	BEFREE	25545857, 27215467		★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Non-Insulin-Dependent	Diabetes Mellitus	BEFREE	22179809, 28196832, 30841431		★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Non-Insulin-Dependent	Diabetes Mellitus	GWASCAT_DG	29221444		★☆☆☆☆ Found in Text Mining only
Endometrial Neoplasms	Endometrial neoplasm	Pubtator	34324032	Stimulate	★☆☆☆☆ Found in Text Mining only
EPILEPTIC ENCEPHALOPATHY, EARLY INFANTILE, 2	Epileptic encephalopathy	BEFREE	28973916		★☆☆☆☆ Found in Text Mining only
Gastroparesis	Gastroparesis	BEFREE	29745439		★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	BEFREE	28495590		★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	Pubtator	40565152	Associate	★☆☆☆☆ Found in Text Mining only
Glioblastoma Multiforme	Glioblastoma	BEFREE	28495590		★☆☆☆☆ Found in Text Mining only
Hepatitis C	Hepatitis c	Pubtator	31200545	Associate	★☆☆☆☆ Found in Text Mining only
Infantile Severe Myoclonic Epilepsy	Myoclonic Epilepsy	BEFREE	28973916		★☆☆☆☆ Found in Text Mining only
Inflammatory Bowel Diseases	Inflammatory Bowel Disease	BEFREE	28272905		★☆☆☆☆ Found in Text Mining only
Leiomyoma	Leiomyoma	Pubtator	30842391	Associate	★☆☆☆☆ Found in Text Mining only
Macular Edema, Cystoid	Cystoid macular edema	BEFREE	29957399		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	29188802		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of skin	Skin cancer	BEFREE	22751111		★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	20818416, 20838378, 22751111, 23063456, 25970609, 28005346, 28495590, 28673732, 29588059, 30830860		★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	CTD_human_DG	27423937		★☆☆☆☆ Found in Text Mining only
Malignant tumor of colon	Colonic Neoplasms	BEFREE	25533906		★☆☆☆☆ Found in Text Mining only
Mental Depression	Mental Depression	BEFREE	29435814		★☆☆☆☆ Found in Text Mining only
Metabolic Diseases	Metabolic Diseases	BEFREE	27215467		★☆☆☆☆ Found in Text Mining only
Mucoepidermoid Carcinoma	Mucoepidermoid Carcinoma	BEFREE	30830860		★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	24942731, 25889562, 28029647, 28875496		★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	CTD_human_DG	27423937		★☆☆☆☆ Found in Text Mining only
Neurodegenerative Disorders	Neurodegenerative Disorders	BEFREE	30687889		★☆☆☆☆ Found in Text Mining only
Non-Small Cell Lung Carcinoma	Lung carcinoma	BEFREE	25889562		★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	BEFREE	22179809, 25970609, 27215467, 28196832, 29588059		★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	Pubtator	25970609	Associate	★☆☆☆☆ Found in Text Mining only
Osteoporosis	Osteoporosis	BEFREE	28673732		★☆☆☆☆ Found in Text Mining only
Pancreatic Ductal Adenocarcinoma	Pancreatic adenocarcinoma	BEFREE	30061636		★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasms	Pancreatic neoplasm	Pubtator	37688769	Associate	★☆☆☆☆ Found in Text Mining only
Papilloma	Papilloma	BEFREE	22751111		★☆☆☆☆ Found in Text Mining only
Parkinson Disease	Parkinson disease	BEFREE	28807673, 30687889		★☆☆☆☆ Found in Text Mining only
Rett Syndrome	Rett Syndrome	BEFREE	30056123		★☆☆☆☆ Found in Text Mining only
Sarcoma Ewing	Sarcoma	Pubtator	39940911	Associate	★☆☆☆☆ Found in Text Mining only
SCLEROSING CHOLANGITIS, NEONATAL	Sclerosing Cholangitis	BEFREE	30465881		★☆☆☆☆ Found in Text Mining only
Septicemia	Septicemia	BEFREE	30347614		★☆☆☆☆ Found in Text Mining only
Skin Neoplasms	Skin Neoplasms	BEFREE	22751111		★☆☆☆☆ Found in Text Mining only
Skin Neoplasms	Skin neoplasm	Pubtator	37688769	Associate	★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma	Carcinoma	BEFREE	22751111		★☆☆☆☆ Found in Text Mining only
Triple Negative Breast Neoplasms	Triple negative breast cancer	Pubtator	27340777	Associate	★☆☆☆☆ Found in Text Mining only
Ulcerative Colitis	Ulcerative colitis	BEFREE	28272905		★☆☆☆☆ Found in Text Mining only