Gene Gene information from NCBI Gene database.
Entrez ID 9283
Gene name G protein-coupled receptor 37 like 1
Gene symbol GPR37L1
Synonyms (NCBI Gene)
ET(B)R-LP-2ETBR-LP-2ETBRLP2
Chromosome 1
Chromosome location 1q32.1
miRNA miRNA information provided by mirtarbase database.
300
miRTarBase ID miRNA Experiments Reference
MIRT017851 hsa-miR-335-5p Microarray 18185580
MIRT623776 hsa-miR-4485-3p HITS-CLIP 23824327
MIRT623775 hsa-miR-6892-3p HITS-CLIP 23824327
MIRT623774 hsa-miR-2276-5p HITS-CLIP 23824327
MIRT623773 hsa-miR-3183 HITS-CLIP 23824327
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
38
GO ID Ontology Definition Evidence Reference
GO:0003085 Process Negative regulation of systemic arterial blood pressure IEA
GO:0003085 Process Negative regulation of systemic arterial blood pressure ISS
GO:0004930 Function G protein-coupled receptor activity IDA 27072655
GO:0004930 Function G protein-coupled receptor activity IEA
GO:0005515 Function Protein binding IPI 20517885, 24749734, 32296183
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
MIM HGNC e!Ensembl
617630 14923 ENSG00000170075
Protein Protein information from UniProt database.
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
O60883
Protein name G-protein coupled receptor 37-like 1 (Endothelin B receptor-like protein 2) (ETBR-LP-2)
Protein function G-protein coupled receptor (PubMed:27072655). Has been shown to bind the neuroprotective and glioprotective factor prosaposin (PSAP), leading to endocytosis followed by an ERK phosphorylation cascade (PubMed:23690594). However, other studies hav
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00001 7tm_1 147 416 7 transmembrane receptor (rhodopsin family) Family
Tissue specificity TISSUE SPECIFICITY: Expressed in primary cortical astrocytes (at protein level) (PubMed:23690594). Expressed in the central nervous system (PubMed:9539149). {ECO:0000269|PubMed:23690594, ECO:0000269|PubMed:9539149}.
Sequence
MRWLWPLAVSLAVILAVGLSRVSGGAPLHLGRHRAETQEQQSRSKRGTEDEEAKGVQQYV
PEEWAEYPRPIHPAGLQPTKPLVATSPNPGKDGGTPDSGQELRGNLTGAPGQRLQIQNPL
YPVTESSYSAYAIMLLALVVFAVGIVGNLSVMCIVWHSYYLKSAWNSILASLALWDFLVL
FFCLPIVIFNEITKQRLLGDVSCRAVPFMEVSSLGVTTFSLCALGIDRFHVATSTLPKVR
PIERCQSILAKLAVIWVGSMTLAVPELLLWQLAQEPAPTMGTLDSCIMKPSASLPESLYS
LVMTYQNARMWWYFGCYFCLPILFTVTCQLVTWRVRGPPGRKSECRASKHEQCESQLNST
VVGLTVVYAFCTLPENVCNIVVAYLSTELTRQTLDLLGLINQFSTFFKGAITPVLL
LCIC
RPLGQAFLDCCCCCCCEECGGASEASAANGSDNKLKTEVSSSIYFHKPRESPPLLPLGTP
C
Sequence length 481
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  Reactome
    Peptide ligand-binding receptors
G alpha (i) signalling events
Associated diseases Disease associations from ClinVar (causal & non-causal) and other databases (OMIM, Orphanet, GWAS, etc.).
1
Evidence Score: ★☆☆☆☆  Gene-disease association found in Text Mining only ★★☆☆☆  Found in Text Mining and Unknown/Other Associations ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
Phenotype Name Clinical Significance Source Evidence Score
DIVERTICULAR DISEASE GWAS catalog
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
Associations from Text Mining Disease associations identified through text mining
Disease Name Disease (Merged) Source PMID Relationship Type Evidence Score
Adult Medulloblastoma Medulloblastoma BEFREE 30452905
★☆☆☆☆
Found in Text Mining only
Childhood Medulloblastoma Medulloblastoma BEFREE 30452905
★☆☆☆☆
Found in Text Mining only
Glioblastoma Glioblastoma BEFREE 30452905
★☆☆☆☆
Found in Text Mining only
Glioblastoma Multiforme Glioblastoma BEFREE 30452905
★☆☆☆☆
Found in Text Mining only
Glioma Glioma BEFREE 30452905
★☆☆☆☆
Found in Text Mining only
Hypertensive disease Hypertension BEFREE 29625592
★☆☆☆☆
Found in Text Mining only
Left Ventricular Hypertrophy Left Ventricular Hypertrophy BEFREE 29625592
★☆☆☆☆
Found in Text Mining only
Medulloblastoma Medulloblastoma BEFREE 30452905
★☆☆☆☆
Found in Text Mining only
Myoclonic Epilepsies, Progressive Myoclonic epilepsy BEFREE 28688853
★☆☆☆☆
Found in Text Mining only
Neoplasms Neoplasms BEFREE 30452905
★☆☆☆☆
Found in Text Mining only